Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | hok-sok/- |
| Location | 4634393..4634650 | Replicon | chromosome |
| Accession | NZ_CP125351 | ||
| Organism | Escherichia fergusonii strain XJ19MCE1 | ||
Toxin (Protein)
| Gene name | hokA | Uniprot ID | - |
| Locus tag | QKW25_RS22795 | Protein ID | WP_196081637.1 |
| Coordinates | 4634393..4634545 (-) | Length | 51 a.a. |
Antitoxin (RNA)
| Gene name | sokA | ||
| Locus tag | - | ||
| Coordinates | 4634602..4634650 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QKW25_RS22765 | 4630256..4630966 | - | 711 | WP_000190514.1 | DUF3053 domain-containing protein | - |
| QKW25_RS22770 | 4631404..4632774 | + | 1371 | WP_000184983.1 | MFS transporter | - |
| QKW25_RS22775 | 4633024..4633314 | + | 291 | WP_000455800.1 | HTH-type transcriptional regulator | - |
| QKW25_RS22780 | 4633596..4633808 | + | 213 | WP_000014594.1 | RNA chaperone/antiterminator CspA | - |
| QKW25_RS22785 | 4633862..4634233 | - | 372 | WP_001037803.1 | membrane protein insertion efficiency factor YidD | - |
| QKW25_RS22790 | 4634345..4634416 | + | 72 | WP_216665726.1 | hypothetical protein | - |
| QKW25_RS22795 | 4634393..4634545 | - | 153 | WP_196081637.1 | type I toxin-antitoxin system toxin HokA | Toxin |
| - | 4634602..4634650 | + | 49 | - | - | Antitoxin |
| QKW25_RS22800 | 4634846..4635205 | - | 360 | WP_141095883.1 | hypothetical protein | - |
| QKW25_RS22805 | 4635274..4637343 | - | 2070 | WP_001291786.1 | glycine--tRNA ligase subunit beta | - |
| QKW25_RS22810 | 4637353..4638264 | - | 912 | WP_001168544.1 | glycine--tRNA ligase subunit alpha | - |
| QKW25_RS22815 | 4638360..4638659 | - | 300 | WP_024256552.1 | YsaB family lipoprotein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 51 a.a. Molecular weight: 6015.26 Da Isoelectric Point: 7.7169
>T282110 WP_196081637.1 NZ_CP125351:c4634545-4634393 [Escherichia fergusonii]
MSQKYRLLSLIVICFTLLFFTWMIRDSLCELHIKQENYELAAFLACKLKE
MSQKYRLLSLIVICFTLLFFTWMIRDSLCELHIKQENYELAAFLACKLKE
Download Length: 153 bp
Antitoxin
Download Length: 49 bp
>AT282110 NZ_CP125351:4634602-4634650 [Escherichia fergusonii]
GCATAGAGGGGCCTCACTTTGATTTATAGTCAGGTGGGGCTTTTCTCTG
GCATAGAGGGGCCTCACTTTGATTTATAGTCAGGTGGGGCTTTTCTCTG
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|