Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type I Classification (family/domain) ldrD-agrB/Ldr(toxin)
Location 4605008..4605227 Replicon chromosome
Accession NZ_CP125351
Organism Escherichia fergusonii strain XJ19MCE1

Toxin (Protein)


Gene name ldrD Uniprot ID -
Locus tag QKW25_RS22650 Protein ID WP_002431793.1
Coordinates 4605008..4605115 (-) Length 36 a.a.

Antitoxin (RNA)


Gene name agrB
Locus tag -
Coordinates 4605164..4605227 (+)

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
QKW25_RS22620 (4600050) 4600050..4601609 + 1560 WP_001070267.1 cellulose biosynthesis c-di-GMP-binding protein BcsE -
QKW25_RS22625 (4601606) 4601606..4601797 + 192 WP_000981122.1 cellulose biosynthesis protein BcsF -
QKW25_RS22630 (4601794) 4601794..4603473 + 1680 WP_000192007.1 cellulose biosynthesis protein BcsG -
QKW25_RS22635 (4603560) 4603560..4603667 - 108 WP_149012441.1 type I toxin-antitoxin system toxin Ldr family protein -
- (4603725) 4603725..4603779 + 55 NuclAT_18 - -
- (4603725) 4603725..4603779 + 55 NuclAT_18 - -
- (4603725) 4603725..4603779 + 55 NuclAT_18 - -
- (4603725) 4603725..4603779 + 55 NuclAT_18 - -
- (4603725) 4603725..4603779 + 55 NuclAT_21 - -
- (4603725) 4603725..4603779 + 55 NuclAT_21 - -
- (4603725) 4603725..4603779 + 55 NuclAT_21 - -
- (4603725) 4603725..4603779 + 55 NuclAT_21 - -
- (4603725) 4603725..4603779 + 55 NuclAT_24 - -
- (4603725) 4603725..4603779 + 55 NuclAT_24 - -
- (4603725) 4603725..4603779 + 55 NuclAT_24 - -
- (4603725) 4603725..4603779 + 55 NuclAT_24 - -
- (4603725) 4603725..4603779 + 55 NuclAT_27 - -
- (4603725) 4603725..4603779 + 55 NuclAT_27 - -
- (4603725) 4603725..4603779 + 55 NuclAT_27 - -
- (4603725) 4603725..4603779 + 55 NuclAT_27 - -
- (4603725) 4603725..4603781 + 57 NuclAT_11 - -
- (4603725) 4603725..4603781 + 57 NuclAT_11 - -
- (4603725) 4603725..4603781 + 57 NuclAT_11 - -
- (4603725) 4603725..4603781 + 57 NuclAT_11 - -
- (4603725) 4603725..4603781 + 57 NuclAT_14 - -
- (4603725) 4603725..4603781 + 57 NuclAT_14 - -
- (4603725) 4603725..4603781 + 57 NuclAT_14 - -
- (4603725) 4603725..4603781 + 57 NuclAT_14 - -
QKW25_RS22640 (4604043) 4604043..4604150 - 108 WP_002431793.1 type I toxin-antitoxin system toxin Ldr family protein -
- (4604208) 4604208..4604262 + 55 NuclAT_19 - -
- (4604208) 4604208..4604262 + 55 NuclAT_19 - -
- (4604208) 4604208..4604262 + 55 NuclAT_19 - -
- (4604208) 4604208..4604262 + 55 NuclAT_19 - -
- (4604208) 4604208..4604262 + 55 NuclAT_22 - -
- (4604208) 4604208..4604262 + 55 NuclAT_22 - -
- (4604208) 4604208..4604262 + 55 NuclAT_22 - -
- (4604208) 4604208..4604262 + 55 NuclAT_22 - -
- (4604208) 4604208..4604262 + 55 NuclAT_25 - -
- (4604208) 4604208..4604262 + 55 NuclAT_25 - -
- (4604208) 4604208..4604262 + 55 NuclAT_25 - -
- (4604208) 4604208..4604262 + 55 NuclAT_25 - -
- (4604208) 4604208..4604262 + 55 NuclAT_28 - -
- (4604208) 4604208..4604262 + 55 NuclAT_28 - -
- (4604208) 4604208..4604262 + 55 NuclAT_28 - -
- (4604208) 4604208..4604262 + 55 NuclAT_28 - -
- (4604208) 4604208..4604264 + 57 NuclAT_12 - -
- (4604208) 4604208..4604264 + 57 NuclAT_12 - -
- (4604208) 4604208..4604264 + 57 NuclAT_12 - -
- (4604208) 4604208..4604264 + 57 NuclAT_12 - -
- (4604208) 4604208..4604264 + 57 NuclAT_15 - -
- (4604208) 4604208..4604264 + 57 NuclAT_15 - -
- (4604208) 4604208..4604264 + 57 NuclAT_15 - -
- (4604208) 4604208..4604264 + 57 NuclAT_15 - -
QKW25_RS22645 (4604526) 4604526..4604633 - 108 WP_283154534.1 type I toxin-antitoxin system toxin Ldr family protein -
QKW25_RS22650 (4605008) 4605008..4605115 - 108 WP_002431793.1 type I toxin-antitoxin system toxin Ldr family protein Toxin
- (4605164) 4605164..4605227 + 64 NuclAT_17 - Antitoxin
- (4605164) 4605164..4605227 + 64 NuclAT_17 - Antitoxin
- (4605164) 4605164..4605227 + 64 NuclAT_17 - Antitoxin
- (4605164) 4605164..4605227 + 64 NuclAT_17 - Antitoxin
- (4605164) 4605164..4605227 + 64 NuclAT_20 - Antitoxin
- (4605164) 4605164..4605227 + 64 NuclAT_20 - Antitoxin
- (4605164) 4605164..4605227 + 64 NuclAT_20 - Antitoxin
- (4605164) 4605164..4605227 + 64 NuclAT_20 - Antitoxin
- (4605164) 4605164..4605227 + 64 NuclAT_23 - Antitoxin
- (4605164) 4605164..4605227 + 64 NuclAT_23 - Antitoxin
- (4605164) 4605164..4605227 + 64 NuclAT_23 - Antitoxin
- (4605164) 4605164..4605227 + 64 NuclAT_23 - Antitoxin
- (4605164) 4605164..4605227 + 64 NuclAT_26 - Antitoxin
- (4605164) 4605164..4605227 + 64 NuclAT_26 - Antitoxin
- (4605164) 4605164..4605227 + 64 NuclAT_26 - Antitoxin
- (4605164) 4605164..4605227 + 64 NuclAT_26 - Antitoxin
- (4605164) 4605164..4605229 + 66 NuclAT_10 - -
- (4605164) 4605164..4605229 + 66 NuclAT_10 - -
- (4605164) 4605164..4605229 + 66 NuclAT_10 - -
- (4605164) 4605164..4605229 + 66 NuclAT_10 - -
- (4605164) 4605164..4605229 + 66 NuclAT_13 - -
- (4605164) 4605164..4605229 + 66 NuclAT_13 - -
- (4605164) 4605164..4605229 + 66 NuclAT_13 - -
- (4605164) 4605164..4605229 + 66 NuclAT_13 - -
QKW25_RS22655 (4605552) 4605552..4606748 + 1197 WP_196081627.1 methionine gamma-lyase -
QKW25_RS22660 (4607034) 4607034..4608332 + 1299 WP_196081628.1 amino acid permease -
QKW25_RS22665 (4608348) 4608348..4609559 - 1212 Protein_4429 sigma 54-interacting transcriptional regulator -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Type I toxin-antitoxin system, toxin Ldr

(1-35)


Sequences

Toxin        


Download         Length: 36 a.a.        Molecular weight: 3837.64 Da        Isoelectric Point: 9.0157

>T282108 WP_002431793.1 NZ_CP125351:c4605115-4605008 [Escherichia fergusonii]
MTLAELGMAFWHDLAAPVIAGILASLIVSWLNKRK

Download         Length: 108 bp

Antitoxin


Download         Length: 64 bp

>AT282108 NZ_CP125351:4605164-4605227 [Escherichia fergusonii]
GTCTAGAGTCAAGATTAGCCCCCGTGGTGTTGTCAGGTGCATACCTGCAACGTGCGGGGGTTTT

Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Download structure file

References