Detailed information of TA system TA282106

Bioinformatically predicted

Overview

TA module

• Type: I
• Classification (family/domain): ldrD-OrzO/Ldr(toxin)
• Location: 4605008..4605229
• Replicon: chromosome
• Accession: NZ_CP125351
• Organism: Escherichia fergusonii strain XJ19MCE1

Toxin (Protein)

• Gene name: ldrD
• Uniprot ID: -
• Locus tag: QKW25_RS22650
• Protein ID: WP_002431793.1
• Coordinates: 4605008..4605115 (-)
• Length: 36 a.a.

Antitoxin (RNA)

Gene name	OrzO
Locus tag	-
Coordinates	4605163..4605229 (+)

Genomic Context

Locus tag	Coordinates	Strand	Size (bp)	Protein ID	Product	Description
QKW25_RS22620	4600050..4601609	+	1560	WP_001070267.1	cellulose biosynthesis c-di-GMP-binding protein BcsE	-
QKW25_RS22625	4601606..4601797	+	192	WP_000981122.1	cellulose biosynthesis protein BcsF	-
QKW25_RS22630	4601794..4603473	+	1680	WP_000192007.1	cellulose biosynthesis protein BcsG	-
QKW25_RS22635	4603560..4603667	-	108	WP_149012441.1	type I toxin-antitoxin system toxin Ldr family protein	-
-	4603725..4603779	+	55	NuclAT_18	-	-
-	4603725..4603779	+	55	NuclAT_18	-	-
-	4603725..4603779	+	55	NuclAT_18	-	-
-	4603725..4603779	+	55	NuclAT_18	-	-
-	4603725..4603779	+	55	NuclAT_21	-	-
-	4603725..4603779	+	55	NuclAT_21	-	-
-	4603725..4603779	+	55	NuclAT_21	-	-
-	4603725..4603779	+	55	NuclAT_21	-	-
-	4603725..4603779	+	55	NuclAT_24	-	-
-	4603725..4603779	+	55	NuclAT_24	-	-
-	4603725..4603779	+	55	NuclAT_24	-	-
-	4603725..4603779	+	55	NuclAT_24	-	-
-	4603725..4603779	+	55	NuclAT_27	-	-
-	4603725..4603779	+	55	NuclAT_27	-	-
-	4603725..4603779	+	55	NuclAT_27	-	-
-	4603725..4603779	+	55	NuclAT_27	-	-
-	4603725..4603781	+	57	NuclAT_11	-	-
-	4603725..4603781	+	57	NuclAT_11	-	-
-	4603725..4603781	+	57	NuclAT_11	-	-
-	4603725..4603781	+	57	NuclAT_11	-	-
-	4603725..4603781	+	57	NuclAT_14	-	-
-	4603725..4603781	+	57	NuclAT_14	-	-
-	4603725..4603781	+	57	NuclAT_14	-	-
-	4603725..4603781	+	57	NuclAT_14	-	-
QKW25_RS22640	4604043..4604150	-	108	WP_002431793.1	type I toxin-antitoxin system toxin Ldr family protein	-
-	4604208..4604262	+	55	NuclAT_19	-	-
-	4604208..4604262	+	55	NuclAT_19	-	-
-	4604208..4604262	+	55	NuclAT_19	-	-
-	4604208..4604262	+	55	NuclAT_19	-	-
-	4604208..4604262	+	55	NuclAT_22	-	-
-	4604208..4604262	+	55	NuclAT_22	-	-
-	4604208..4604262	+	55	NuclAT_22	-	-
-	4604208..4604262	+	55	NuclAT_22	-	-
-	4604208..4604262	+	55	NuclAT_25	-	-
-	4604208..4604262	+	55	NuclAT_25	-	-
-	4604208..4604262	+	55	NuclAT_25	-	-
-	4604208..4604262	+	55	NuclAT_25	-	-
-	4604208..4604262	+	55	NuclAT_28	-	-
-	4604208..4604262	+	55	NuclAT_28	-	-
-	4604208..4604262	+	55	NuclAT_28	-	-
-	4604208..4604262	+	55	NuclAT_28	-	-
-	4604208..4604264	+	57	NuclAT_12	-	-
-	4604208..4604264	+	57	NuclAT_12	-	-
-	4604208..4604264	+	57	NuclAT_12	-	-
-	4604208..4604264	+	57	NuclAT_12	-	-
-	4604208..4604264	+	57	NuclAT_15	-	-
-	4604208..4604264	+	57	NuclAT_15	-	-
-	4604208..4604264	+	57	NuclAT_15	-	-
-	4604208..4604264	+	57	NuclAT_15	-	-
QKW25_RS22645	4604526..4604633	-	108	WP_283154534.1	type I toxin-antitoxin system toxin Ldr family protein	-
QKW25_RS22650	4605008..4605115	-	108	WP_002431793.1	type I toxin-antitoxin system toxin Ldr family protein	Toxin
-	4605163..4605229	+	67	-	-	Antitoxin
QKW25_RS22655	4605552..4606748	+	1197	WP_196081627.1	methionine gamma-lyase	-
QKW25_RS22660	4607034..4608332	+	1299	WP_196081628.1	amino acid permease	-
QKW25_RS22665	4608348..4609559	-	1212	Protein_4429	sigma 54-interacting transcriptional regulator	-

Associated MGEs

MGE detail	Similar MGEs	Relative position	MGE Type	Cargo ARG	Virulence gene	Coordinates	Length (bp)

Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.

Domains

Predicted by InterproScan

Toxin

• Type I toxin-antitoxin system, toxin Ldr (1-35)

Sequences

Toxin

Protein

• Length: 36 a.a.
• Molecular weight: 3837.64 Da
• Isoelectric Point: 9.0157

>T282106 WP_002431793.1 NZ_CP125351:c4605115-4605008 [Escherichia fergusonii]
MTLAELGMAFWHDLAAPVIAGILASLIVSWLNKRK

Nucleotide

• Length: 108 bp

Antitoxin

Nucleotide

• Length: 67 bp

>AT282106 NZ_CP125351:4605163-4605229 [Escherichia fergusonii]
GGTCTAGAGTCAAGATTAGCCCCCGTGGTGTTGTCAGGTGCATACCTGCAACGTGCGGGGGTTTTCT

Structures

Antitoxin