Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | ldrD-OrzO/Ldr(toxin) |
Location | 4603560..4603779 | Replicon | chromosome |
Accession | NZ_CP125351 | ||
Organism | Escherichia fergusonii strain XJ19MCE1 |
Toxin (Protein)
Gene name | ldrD | Uniprot ID | - |
Locus tag | QKW25_RS22635 | Protein ID | WP_149012441.1 |
Coordinates | 4603560..4603667 (-) | Length | 36 a.a. |
Antitoxin (RNA)
Gene name | OrzO | ||
Locus tag | - | ||
Coordinates | 4603725..4603779 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QKW25_RS22610 (4598796) | 4598796..4599563 | - | 768 | WP_000279500.1 | cellulose biosynthesis protein BcsQ | - |
QKW25_RS22615 (4599575) | 4599575..4599763 | - | 189 | WP_001063310.1 | cellulose biosynthesis protein BcsR | - |
QKW25_RS22620 (4600050) | 4600050..4601609 | + | 1560 | WP_001070267.1 | cellulose biosynthesis c-di-GMP-binding protein BcsE | - |
QKW25_RS22625 (4601606) | 4601606..4601797 | + | 192 | WP_000981122.1 | cellulose biosynthesis protein BcsF | - |
QKW25_RS22630 (4601794) | 4601794..4603473 | + | 1680 | WP_000192007.1 | cellulose biosynthesis protein BcsG | - |
QKW25_RS22635 (4603560) | 4603560..4603667 | - | 108 | WP_149012441.1 | type I toxin-antitoxin system toxin Ldr family protein | Toxin |
- (4603725) | 4603725..4603779 | + | 55 | NuclAT_18 | - | Antitoxin |
- (4603725) | 4603725..4603779 | + | 55 | NuclAT_18 | - | Antitoxin |
- (4603725) | 4603725..4603779 | + | 55 | NuclAT_18 | - | Antitoxin |
- (4603725) | 4603725..4603779 | + | 55 | NuclAT_18 | - | Antitoxin |
- (4603725) | 4603725..4603779 | + | 55 | NuclAT_21 | - | Antitoxin |
- (4603725) | 4603725..4603779 | + | 55 | NuclAT_21 | - | Antitoxin |
- (4603725) | 4603725..4603779 | + | 55 | NuclAT_21 | - | Antitoxin |
- (4603725) | 4603725..4603779 | + | 55 | NuclAT_21 | - | Antitoxin |
- (4603725) | 4603725..4603779 | + | 55 | NuclAT_24 | - | Antitoxin |
- (4603725) | 4603725..4603779 | + | 55 | NuclAT_24 | - | Antitoxin |
- (4603725) | 4603725..4603779 | + | 55 | NuclAT_24 | - | Antitoxin |
- (4603725) | 4603725..4603779 | + | 55 | NuclAT_24 | - | Antitoxin |
- (4603725) | 4603725..4603779 | + | 55 | NuclAT_27 | - | Antitoxin |
- (4603725) | 4603725..4603779 | + | 55 | NuclAT_27 | - | Antitoxin |
- (4603725) | 4603725..4603779 | + | 55 | NuclAT_27 | - | Antitoxin |
- (4603725) | 4603725..4603779 | + | 55 | NuclAT_27 | - | Antitoxin |
- (4603725) | 4603725..4603781 | + | 57 | NuclAT_11 | - | - |
- (4603725) | 4603725..4603781 | + | 57 | NuclAT_11 | - | - |
- (4603725) | 4603725..4603781 | + | 57 | NuclAT_11 | - | - |
- (4603725) | 4603725..4603781 | + | 57 | NuclAT_11 | - | - |
- (4603725) | 4603725..4603781 | + | 57 | NuclAT_14 | - | - |
- (4603725) | 4603725..4603781 | + | 57 | NuclAT_14 | - | - |
- (4603725) | 4603725..4603781 | + | 57 | NuclAT_14 | - | - |
- (4603725) | 4603725..4603781 | + | 57 | NuclAT_14 | - | - |
QKW25_RS22640 (4604043) | 4604043..4604150 | - | 108 | WP_002431793.1 | type I toxin-antitoxin system toxin Ldr family protein | - |
- (4604208) | 4604208..4604262 | + | 55 | NuclAT_19 | - | - |
- (4604208) | 4604208..4604262 | + | 55 | NuclAT_19 | - | - |
- (4604208) | 4604208..4604262 | + | 55 | NuclAT_19 | - | - |
- (4604208) | 4604208..4604262 | + | 55 | NuclAT_19 | - | - |
- (4604208) | 4604208..4604262 | + | 55 | NuclAT_22 | - | - |
- (4604208) | 4604208..4604262 | + | 55 | NuclAT_22 | - | - |
- (4604208) | 4604208..4604262 | + | 55 | NuclAT_22 | - | - |
- (4604208) | 4604208..4604262 | + | 55 | NuclAT_22 | - | - |
- (4604208) | 4604208..4604262 | + | 55 | NuclAT_25 | - | - |
- (4604208) | 4604208..4604262 | + | 55 | NuclAT_25 | - | - |
- (4604208) | 4604208..4604262 | + | 55 | NuclAT_25 | - | - |
- (4604208) | 4604208..4604262 | + | 55 | NuclAT_25 | - | - |
- (4604208) | 4604208..4604262 | + | 55 | NuclAT_28 | - | - |
- (4604208) | 4604208..4604262 | + | 55 | NuclAT_28 | - | - |
- (4604208) | 4604208..4604262 | + | 55 | NuclAT_28 | - | - |
- (4604208) | 4604208..4604262 | + | 55 | NuclAT_28 | - | - |
- (4604208) | 4604208..4604264 | + | 57 | NuclAT_12 | - | - |
- (4604208) | 4604208..4604264 | + | 57 | NuclAT_12 | - | - |
- (4604208) | 4604208..4604264 | + | 57 | NuclAT_12 | - | - |
- (4604208) | 4604208..4604264 | + | 57 | NuclAT_12 | - | - |
- (4604208) | 4604208..4604264 | + | 57 | NuclAT_15 | - | - |
- (4604208) | 4604208..4604264 | + | 57 | NuclAT_15 | - | - |
- (4604208) | 4604208..4604264 | + | 57 | NuclAT_15 | - | - |
- (4604208) | 4604208..4604264 | + | 57 | NuclAT_15 | - | - |
QKW25_RS22645 (4604526) | 4604526..4604633 | - | 108 | WP_283154534.1 | type I toxin-antitoxin system toxin Ldr family protein | - |
QKW25_RS22650 (4605008) | 4605008..4605115 | - | 108 | WP_002431793.1 | type I toxin-antitoxin system toxin Ldr family protein | - |
- (4605164) | 4605164..4605227 | + | 64 | NuclAT_17 | - | - |
- (4605164) | 4605164..4605227 | + | 64 | NuclAT_17 | - | - |
- (4605164) | 4605164..4605227 | + | 64 | NuclAT_17 | - | - |
- (4605164) | 4605164..4605227 | + | 64 | NuclAT_17 | - | - |
- (4605164) | 4605164..4605227 | + | 64 | NuclAT_20 | - | - |
- (4605164) | 4605164..4605227 | + | 64 | NuclAT_20 | - | - |
- (4605164) | 4605164..4605227 | + | 64 | NuclAT_20 | - | - |
- (4605164) | 4605164..4605227 | + | 64 | NuclAT_20 | - | - |
- (4605164) | 4605164..4605227 | + | 64 | NuclAT_23 | - | - |
- (4605164) | 4605164..4605227 | + | 64 | NuclAT_23 | - | - |
- (4605164) | 4605164..4605227 | + | 64 | NuclAT_23 | - | - |
- (4605164) | 4605164..4605227 | + | 64 | NuclAT_23 | - | - |
- (4605164) | 4605164..4605227 | + | 64 | NuclAT_26 | - | - |
- (4605164) | 4605164..4605227 | + | 64 | NuclAT_26 | - | - |
- (4605164) | 4605164..4605227 | + | 64 | NuclAT_26 | - | - |
- (4605164) | 4605164..4605227 | + | 64 | NuclAT_26 | - | - |
- (4605164) | 4605164..4605229 | + | 66 | NuclAT_10 | - | - |
- (4605164) | 4605164..4605229 | + | 66 | NuclAT_10 | - | - |
- (4605164) | 4605164..4605229 | + | 66 | NuclAT_10 | - | - |
- (4605164) | 4605164..4605229 | + | 66 | NuclAT_10 | - | - |
- (4605164) | 4605164..4605229 | + | 66 | NuclAT_13 | - | - |
- (4605164) | 4605164..4605229 | + | 66 | NuclAT_13 | - | - |
- (4605164) | 4605164..4605229 | + | 66 | NuclAT_13 | - | - |
- (4605164) | 4605164..4605229 | + | 66 | NuclAT_13 | - | - |
QKW25_RS22655 (4605552) | 4605552..4606748 | + | 1197 | WP_196081627.1 | methionine gamma-lyase | - |
QKW25_RS22660 (4607034) | 4607034..4608332 | + | 1299 | WP_196081628.1 | amino acid permease | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 36 a.a. Molecular weight: 3894.69 Da Isoelectric Point: 9.0157
>T282098 WP_149012441.1 NZ_CP125351:c4603667-4603560 [Escherichia fergusonii]
MTLAELGIAFWHDLAAPVITGILASMIVNWLNKRK
MTLAELGIAFWHDLAAPVITGILASMIVNWLNKRK
Download Length: 108 bp
Antitoxin
Download Length: 55 bp
>AT282098 NZ_CP125351:4603725-4603779 [Escherichia fergusonii]
CAAGAATGGCCCCCGTGATGTTGTCAGGTGCATACCTGCAACGTGCGGGGGTTTT
CAAGAATGGCCCCCGTGATGTTGTCAGGTGCATACCTGCAACGTGCGGGGGTTTT
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|