Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | yafN-yafO (relBE)/YafO-YafN |
| Location | 3803556..3804250 | Replicon | chromosome |
| Accession | NZ_CP125351 | ||
| Organism | Escherichia fergusonii strain XJ19MCE1 | ||
Toxin (Protein)
| Gene name | yafO | Uniprot ID | - |
| Locus tag | QKW25_RS18780 | Protein ID | WP_181665641.1 |
| Coordinates | 3803556..3803954 (-) | Length | 133 a.a. |
Antitoxin (Protein)
| Gene name | yafN | Uniprot ID | - |
| Locus tag | QKW25_RS18785 | Protein ID | WP_046080635.1 |
| Coordinates | 3803957..3804250 (-) | Length | 98 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QKW25_RS18755 (3798920) | 3798920..3799378 | - | 459 | WP_001291987.1 | xanthine phosphoribosyltransferase | - |
| QKW25_RS18760 (3799639) | 3799639..3801096 | + | 1458 | WP_001293012.1 | cytosol nonspecific dipeptidase | - |
| QKW25_RS18765 (3801153) | 3801153..3801767 | - | 615 | WP_196082032.1 | peptide chain release factor H | - |
| QKW25_RS18770 (3801764) | 3801764..3802903 | - | 1140 | WP_196082033.1 | RNA ligase RtcB family protein | - |
| QKW25_RS18775 (3803094) | 3803094..3803546 | - | 453 | WP_196082034.1 | GNAT family N-acetyltransferase | - |
| QKW25_RS18780 (3803556) | 3803556..3803954 | - | 399 | WP_181665641.1 | type II toxin-antitoxin system mRNA interferase toxin YafO | Toxin |
| QKW25_RS18785 (3803957) | 3803957..3804250 | - | 294 | WP_046080635.1 | type I toxin-antitoxin system antitoxin YafN | Antitoxin |
| QKW25_RS18790 (3804302) | 3804302..3805357 | - | 1056 | WP_001226156.1 | DNA polymerase IV | - |
| QKW25_RS18795 (3805428) | 3805428..3806213 | - | 786 | WP_196082035.1 | putative lateral flagellar export/assembly protein LafU | - |
| QKW25_RS18800 (3806185) | 3806185..3807897 | + | 1713 | Protein_3671 | flagellar biosynthesis protein FlhA | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 133 a.a. Molecular weight: 15408.83 Da Isoelectric Point: 9.6253
>T282096 WP_181665641.1 NZ_CP125351:c3803954-3803556 [Escherichia fergusonii]
MRVFKTKLIRLQLTAKELDALTADFISSKRDGVLPDIFGRDALYDDSFTWPLIKFERVAHIHLANENNPFPPQLRQFSRT
NDEAHLVYCQGAFDEQVRLLIAILKPEPHKLARDNNQMHKIGKMAEAFRMRF
MRVFKTKLIRLQLTAKELDALTADFISSKRDGVLPDIFGRDALYDDSFTWPLIKFERVAHIHLANENNPFPPQLRQFSRT
NDEAHLVYCQGAFDEQVRLLIAILKPEPHKLARDNNQMHKIGKMAEAFRMRF
Download Length: 399 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|