Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | hok-sok/- |
| Location | 2931776..2932001 | Replicon | chromosome |
| Accession | NZ_CP125351 | ||
| Organism | Escherichia fergusonii strain XJ19MCE1 | ||
Toxin (Protein)
| Gene name | hokW | Uniprot ID | A0A1Q4PF16 |
| Locus tag | QKW25_RS14430 | Protein ID | WP_000813258.1 |
| Coordinates | 2931776..2931931 (-) | Length | 52 a.a. |
Antitoxin (RNA)
| Gene name | sokW | ||
| Locus tag | - | ||
| Coordinates | 2931943..2932001 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QKW25_RS14370 | 2926865..2927047 | - | 183 | WP_032145233.1 | Rz1 family lipoprotein | - |
| QKW25_RS14375 | 2927264..2927797 | - | 534 | WP_000992100.1 | lysozyme | - |
| QKW25_RS14380 | 2927861..2928211 | - | 351 | WP_001545374.1 | YdfR family protein | - |
| QKW25_RS14385 | 2928216..2928431 | - | 216 | WP_000839572.1 | class II holin family protein | - |
| QKW25_RS14410 | 2929228..2929917 | - | 690 | WP_001546004.1 | bacteriophage antitermination protein Q | - |
| QKW25_RS14415 | 2929914..2930273 | - | 360 | WP_196081826.1 | RusA family crossover junction endodeoxyribonuclease | - |
| QKW25_RS14420 | 2930286..2931335 | - | 1050 | WP_196081827.1 | DUF968 domain-containing protein | - |
| QKW25_RS14425 | 2931337..2931609 | - | 273 | WP_012565094.1 | hypothetical protein | - |
| QKW25_RS14430 | 2931776..2931931 | - | 156 | WP_000813258.1 | Hok/Gef family protein | Toxin |
| - | 2931943..2932001 | + | 59 | - | - | Antitoxin |
| QKW25_RS14435 | 2932222..2932566 | - | 345 | WP_000206825.1 | hypothetical protein | - |
| QKW25_RS14440 | 2932563..2932928 | - | 366 | WP_001229296.1 | HNH endonuclease signature motif containing protein | - |
| QKW25_RS14445 | 2932930..2933148 | - | 219 | WP_196081828.1 | DUF4014 family protein | - |
| QKW25_RS14450 | 2933150..2933578 | - | 429 | WP_097762185.1 | hypothetical protein | - |
| QKW25_RS14455 | 2933674..2934030 | - | 357 | WP_001514295.1 | hypothetical protein | - |
| QKW25_RS14460 | 2934032..2934595 | - | 564 | WP_155104913.1 | hypothetical protein | - |
| QKW25_RS14465 | 2934561..2934860 | - | 300 | WP_032201977.1 | DUF4406 domain-containing protein | - |
| QKW25_RS14470 | 2934857..2935279 | - | 423 | WP_196081829.1 | DUF977 family protein | - |
| QKW25_RS14475 | 2935320..2936390 | - | 1071 | WP_196081830.1 | phage replisome organizer | - |
| QKW25_RS14480 | 2936462..2936887 | - | 426 | WP_196081831.1 | toxin YdaT family protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Prophage | - | tssA / tssM | 2886973..2955940 | 68967 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 52 a.a. Molecular weight: 5767.95 Da Isoelectric Point: 7.7942
>T282092 WP_000813258.1 NZ_CP125351:c2931931-2931776 [Escherichia fergusonii]
MKQQKAMLIALIVICLTVIVTALVTRKDLCEVRIRTGQTEVAVFVDYESEK
MKQQKAMLIALIVICLTVIVTALVTRKDLCEVRIRTGQTEVAVFVDYESEK
Download Length: 156 bp
Antitoxin
Download Length: 59 bp
>AT282092 NZ_CP125351:2931943-2932001 [Escherichia fergusonii]
CCTTGCCTTTCGGCACGTAAGAGGCTAACCTACATTTGTGAGACATAGATTGGGCCTCA
CCTTGCCTTTCGGCACGTAAGAGGCTAACCTACATTTGTGAGACATAGATTGGGCCTCA
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
