Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | hok-sok/- |
| Location | 747068..747326 | Replicon | chromosome |
| Accession | NZ_CP125351 | ||
| Organism | Escherichia fergusonii strain XJ19MCE1 | ||
Toxin (Protein)
| Gene name | hokC | Uniprot ID | S1NX00 |
| Locus tag | QKW25_RS03740 | Protein ID | WP_000809168.1 |
| Coordinates | 747068..747220 (-) | Length | 51 a.a. |
Antitoxin (RNA)
| Gene name | sokC | ||
| Locus tag | - | ||
| Coordinates | 747269..747326 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QKW25_RS03720 | 742133..742720 | + | 588 | WP_002431696.1 | molybdopterin adenylyltransferase | - |
| QKW25_RS03725 | 742754..743320 | - | 567 | WP_000528529.1 | acetate uptake transporter | - |
| QKW25_RS03730 | 743828..745744 | + | 1917 | WP_000516135.1 | molecular chaperone DnaK | - |
| QKW25_RS03735 | 745833..746963 | + | 1131 | WP_001118464.1 | molecular chaperone DnaJ | - |
| QKW25_RS03740 | 747068..747220 | - | 153 | WP_000809168.1 | type I toxin-antitoxin system toxin MokC | Toxin |
| - | 747269..747326 | + | 58 | - | - | Antitoxin |
| QKW25_RS03745 | 747761..748927 | + | 1167 | WP_000681374.1 | Na+/H+ antiporter NhaA | - |
| QKW25_RS03750 | 748995..749894 | + | 900 | WP_000019049.1 | transcriptional activator NhaR | - |
| QKW25_RS03755 | 749990..750253 | - | 264 | WP_001274021.1 | 30S ribosomal protein S20 | - |
| QKW25_RS03760 | 750356..750574 | + | 219 | WP_196081237.1 | DUF2575 domain-containing protein | - |
| QKW25_RS03765 | 750582..751523 | + | 942 | WP_046081994.1 | bifunctional riboflavin kinase/FAD synthetase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 51 a.a. Molecular weight: 5501.57 Da Isoelectric Point: 7.1312
>T282083 WP_000809168.1 NZ_CP125351:c747220-747068 [Escherichia fergusonii]
MKQHKAMIVALIVICITAVVAALVTRKDLCEVHIRTGQTEVAVFTAYESE
MKQHKAMIVALIVICITAVVAALVTRKDLCEVHIRTGQTEVAVFTAYESE
Download Length: 153 bp
Antitoxin
Download Length: 58 bp
>AT282083 NZ_CP125351:747269-747326 [Escherichia fergusonii]
GTTCAGCATATAGGGGGCCTCGGGTTGATGGTAAAATATCACTCGGGGCTTTTCTCTA
GTTCAGCATATAGGGGGCCTCGGGTTGATGGTAAAATATCACTCGGGGCTTTTCTCTA
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|