Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | prlF-yhaV (relBE)/YhaV-PrlF |
| Location | 606212..607011 | Replicon | chromosome |
| Accession | NZ_CP125351 | ||
| Organism | Escherichia fergusonii strain XJ19MCE1 | ||
Toxin (Protein)
| Gene name | yhaV | Uniprot ID | - |
| Locus tag | QKW25_RS02920 | Protein ID | WP_196082266.1 |
| Coordinates | 606212..606676 (-) | Length | 155 a.a. |
Antitoxin (Protein)
| Gene name | prlF | Uniprot ID | B7LMV4 |
| Locus tag | QKW25_RS02925 | Protein ID | WP_015953962.1 |
| Coordinates | 606676..607011 (-) | Length | 112 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QKW25_RS02890 (601214) | 601214..601648 | - | 435 | WP_196082267.1 | PTS galactosamine/N-acetylgalactosamine transporter subunit IIA | - |
| QKW25_RS02895 (601666) | 601666..602544 | - | 879 | WP_283154601.1 | PTS N-acetylgalactosamine transporter subunit IID | - |
| QKW25_RS02900 (602534) | 602534..603313 | - | 780 | WP_089559022.1 | PTS N-acetylgalactosamine transporter subunit IIC | - |
| QKW25_RS02905 (603324) | 603324..603797 | - | 474 | WP_032303829.1 | PTS N-acetylgalactosamine transporter subunit IIB | - |
| QKW25_RS02910 (603820) | 603820..605100 | - | 1281 | WP_180491940.1 | tagatose-bisphosphate aldolase subunit KbaZ | - |
| QKW25_RS02915 (605348) | 605348..606157 | + | 810 | WP_000072187.1 | aga operon transcriptional regulator AgaR | - |
| QKW25_RS02920 (606212) | 606212..606676 | - | 465 | WP_196082266.1 | type II toxin-antitoxin system ribonuclease toxin YhaV | Toxin |
| QKW25_RS02925 (606676) | 606676..607011 | - | 336 | WP_015953962.1 | type II toxin-antitoxin system antitoxin PrlF | Antitoxin |
| QKW25_RS02930 (607160) | 607160..608731 | - | 1572 | WP_148047939.1 | galactarate dehydratase | - |
| QKW25_RS02935 (609202) | 609202..609972 | + | 771 | WP_148047940.1 | 2-dehydro-3-deoxyglucarate aldolase | - |
| QKW25_RS02940 (609997) | 609997..610887 | + | 891 | WP_000178100.1 | 2-hydroxy-3-oxopropionate reductase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 155 a.a. Molecular weight: 17832.31 Da Isoelectric Point: 9.6924
>T282082 WP_196082266.1 NZ_CP125351:c606676-606212 [Escherichia fergusonii]
MDFPQRVNGWALYAHPCFQETYDALVAEVETLKGKDPENYQRKAATKLLAVVHKVIEEHITVNPSSPAFRHGKSLGSGKN
KDWSRVKFGAGRYRLFFRYSEKEKVIILGWMNDENTLRTYGKKTDAYTVFIKMLKRGHPPADWETLTRETEEAH
MDFPQRVNGWALYAHPCFQETYDALVAEVETLKGKDPENYQRKAATKLLAVVHKVIEEHITVNPSSPAFRHGKSLGSGKN
KDWSRVKFGAGRYRLFFRYSEKEKVIILGWMNDENTLRTYGKKTDAYTVFIKMLKRGHPPADWETLTRETEEAH
Download Length: 465 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|