Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/HigB-HigA |
| Location | 32693..33420 | Replicon | plasmid pWYKP594-1 |
| Accession | NZ_CP125350 | ||
| Organism | Klebsiella pneumoniae strain WYKP594 | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | A0A7W3D9W1 |
| Locus tag | QJR22_RS28555 | Protein ID | WP_011251285.1 |
| Coordinates | 33109..33420 (-) | Length | 104 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | - |
| Locus tag | QJR22_RS28550 | Protein ID | WP_011251286.1 |
| Coordinates | 32693..33112 (-) | Length | 140 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QJR22_RS28525 (QJR22_28530) | 28273..29241 | - | 969 | WP_013362812.1 | IS5-like element IS903B family transposase | - |
| QJR22_RS28530 (QJR22_28535) | 29698..30318 | + | 621 | WP_223175004.1 | conjugative transfer protein MobI(A/C) | - |
| QJR22_RS28535 (QJR22_28540) | 30339..31127 | + | 789 | WP_040217257.1 | hypothetical protein | - |
| QJR22_RS28540 (QJR22_28545) | 31141..31506 | + | 366 | WP_048333448.1 | hypothetical protein | - |
| QJR22_RS28545 (QJR22_28550) | 31578..32546 | - | 969 | WP_074428168.1 | IS5 family transposase | - |
| QJR22_RS28550 (QJR22_28555) | 32693..33112 | - | 420 | WP_011251286.1 | helix-turn-helix domain-containing protein | Antitoxin |
| QJR22_RS28555 (QJR22_28560) | 33109..33420 | - | 312 | WP_011251285.1 | type II toxin-antitoxin system HigB family toxin | Toxin |
| QJR22_RS28560 (QJR22_28565) | 33625..34062 | - | 438 | Protein_31 | DDE-type integrase/transposase/recombinase | - |
| QJR22_RS28565 (QJR22_28570) | 34197..34895 | + | 699 | Protein_32 | IS1-like element IS1A family transposase | - |
| QJR22_RS28570 (QJR22_28575) | 34897..35346 | + | 450 | WP_011251283.1 | thioredoxin fold domain-containing protein | - |
| QJR22_RS28575 (QJR22_28580) | 35363..35674 | + | 312 | WP_011251282.1 | hypothetical protein | - |
| QJR22_RS28580 (QJR22_28585) | 35688..36029 | + | 342 | WP_011251281.1 | hypothetical protein | - |
| QJR22_RS28585 (QJR22_28590) | 36089..37045 | + | 957 | WP_011251280.1 | DsbA family protein | - |
| QJR22_RS28590 (QJR22_28595) | 37470..37910 | - | 441 | WP_011251275.1 | hypothetical protein | - |
| QJR22_RS28595 (QJR22_28600) | 37916..38410 | - | 495 | WP_011251274.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Mobilizable plasmid | - | iroN / rmpA / rmpA / iucA / iucB / iucC / iucD / iutA / rmpA2 | 1..217743 | 217743 | |
| - | inside | IScluster/Tn | - | - | 14899..40330 | 25431 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 104 a.a. Molecular weight: 12346.12 Da Isoelectric Point: 9.7248
>T282078 WP_011251285.1 NZ_CP125350:c33420-33109 [Klebsiella pneumoniae]
MHVISKEPFEEAAKRYPNDSLAIRALYRLVRETDFSSPAEMLTLIPSLDNFKYRNKWWVLDVGGNNLRVIAYINFVNKRF
YVKHIATHADYDKLTRYYRENKE
MHVISKEPFEEAAKRYPNDSLAIRALYRLVRETDFSSPAEMLTLIPSLDNFKYRNKWWVLDVGGNNLRVIAYINFVNKRF
YVKHIATHADYDKLTRYYRENKE
Download Length: 312 bp
Antitoxin
Download Length: 140 a.a. Molecular weight: 15377.46 Da Isoelectric Point: 4.4420
>AT282078 WP_011251286.1 NZ_CP125350:c33112-32693 [Klebsiella pneumoniae]
MITDTAKAIEATKQLVAAVPFLGGSSSESDYREAMELVDYLIENDDENPLIDFLASKIADYEDNSPRFAEFNKAIAEIPV
GVALLRTLIDQHKLSYSDLKDEIGSKSLVSQILSGQRSLTITHIKALSARFGVKPEWFL
MITDTAKAIEATKQLVAAVPFLGGSSSESDYREAMELVDYLIENDDENPLIDFLASKIADYEDNSPRFAEFNKAIAEIPV
GVALLRTLIDQHKLSYSDLKDEIGSKSLVSQILSGQRSLTITHIKALSARFGVKPEWFL
Download Length: 420 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|