282065

Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) phd-doc/Doc-RelB
Location 330390..330976 Replicon chromosome
Accession NZ_CP125349
Organism Klebsiella pneumoniae strain WYKP594

Toxin (Protein)


Gene name doc Uniprot ID W8VD46
Locus tag QJR22_RS02905 Protein ID WP_002920800.1
Coordinates 330608..330976 (+) Length 123 a.a.

Antitoxin (Protein)


Gene name phd Uniprot ID A0A0H3GZM4
Locus tag QJR22_RS02900 Protein ID WP_002920802.1
Coordinates 330390..330611 (+) Length 74 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
QJR22_RS02880 (QJR22_02880) 326547..327473 + 927 WP_002920807.1 high-affinity branched-chain amino acid ABC transporter permease LivH -
QJR22_RS02885 (QJR22_02885) 327470..328747 + 1278 WP_217289780.1 high-affinity branched-chain amino acid ABC transporter permease LivM -
QJR22_RS02890 (QJR22_02890) 328744..329511 + 768 WP_002920803.1 high-affinity branched-chain amino acid ABC transporter ATP-binding protein LivG -
QJR22_RS02895 (QJR22_02895) 329513..330226 + 714 WP_004145133.1 high-affinity branched-chain amino acid ABC transporter ATP-binding protein LivF -
QJR22_RS02900 (QJR22_02900) 330390..330611 + 222 WP_002920802.1 type II toxin-antitoxin system Phd/YefM family antitoxin Antitoxin
QJR22_RS02905 (QJR22_02905) 330608..330976 + 369 WP_002920800.1 type II toxin-antitoxin system death-on-curing family toxin Toxin
QJR22_RS02910 (QJR22_02910) 331249..332565 + 1317 WP_002920796.1 sn-glycerol-3-phosphate ABC transporter substrate-binding protein UgpB -
QJR22_RS02915 (QJR22_02915) 332672..333559 + 888 WP_002920792.1 sn-glycerol-3-phosphate ABC transporter permease UgpA -
QJR22_RS02920 (QJR22_02920) 333556..334401 + 846 WP_002920789.1 sn-glycerol-3-phosphate ABC transporter permease UgpE -
QJR22_RS02925 (QJR22_02925) 334403..335473 + 1071 WP_002920787.1 sn-glycerol-3-phosphate import ATP-binding protein UgpC -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
inside Prophage - - 327470..336210 8740


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Fido domain

(13-86)

Antitoxin

Type II toxin-antitoxin system, antitoxin Phd/YefM

(1-49)


Sequences

Toxin        


Download         Length: 123 a.a.        Molecular weight: 13552.92 Da        Isoelectric Point: 8.6410

>T282065 WP_002920800.1 NZ_CP125349:330608-330976 [Klebsiella pneumoniae]
MTLQIISAEEIIQFHDRLLRVTPGVAGMPDPGRAEAIMYRVLNKIEYEGVTDVWRLAAMHLLAISRGHIFNDGNKRTALF
ITLLFLKRNGIILPANPDFVGMTVEAAAGQLTLEQIVARLRG

Download         Length: 369 bp

Antitoxin


Download         Length: 74 a.a.        Molecular weight: 8181.18 Da        Isoelectric Point: 4.7769

>AT282065 WP_002920802.1 NZ_CP125349:330390-330611 [Klebsiella pneumoniae]
MRTVNYSEARQNLADVLESAVTGVPVTITRRGHKSAVIISAEEFERYQTARMDDEFAAIMAVHGDEIRELADK

Download         Length: 222 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A0H3GUD1

Antitoxin

Source ID Structure
AlphaFold DB A0A0H3GZM4

References