Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | hok-sok/- |
| Location | 25899..26152 | Replicon | plasmid pWYKP594-4 |
| Accession | NZ_CP125346 | ||
| Organism | Klebsiella pneumoniae strain WYKP594 | ||
Toxin (Protein)
| Gene name | srnB | Uniprot ID | G9G1E3 |
| Locus tag | QJR22_RS00240 | Protein ID | WP_001312851.1 |
| Coordinates | 25899..26048 (-) | Length | 50 a.a. |
Antitoxin (RNA)
| Gene name | srnC | ||
| Locus tag | - | ||
| Coordinates | 26093..26152 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QJR22_RS00205 (21258) | 21258..21673 | - | 416 | Protein_30 | IS1-like element IS1B family transposase | - |
| QJR22_RS00210 (21922) | 21922..22323 | - | 402 | WP_001398199.1 | type II toxin-antitoxin system toxin endoribonuclease PemK | - |
| QJR22_RS00215 (22256) | 22256..22513 | - | 258 | WP_000557619.1 | type II toxin-antitoxin system antitoxin PemI | - |
| QJR22_RS00220 (22606) | 22606..23259 | - | 654 | WP_000616807.1 | CPBP family intramembrane metalloprotease | - |
| QJR22_RS00225 (24198) | 24198..25055 | - | 858 | WP_032495102.1 | incFII family plasmid replication initiator RepA | - |
| QJR22_RS00230 (25048) | 25048..25122 | - | 75 | WP_001375168.1 | RepA leader peptide Tap | - |
| QJR22_RS00235 (25367) | 25367..25615 | - | 249 | WP_000083837.1 | replication regulatory protein RepA | - |
| QJR22_RS00240 (25899) | 25899..26048 | - | 150 | WP_001312851.1 | Hok/Gef family protein | Toxin |
| - (26093) | 26093..26152 | + | 60 | NuclAT_1 | - | Antitoxin |
| - (26093) | 26093..26152 | + | 60 | NuclAT_1 | - | Antitoxin |
| - (26093) | 26093..26152 | + | 60 | NuclAT_1 | - | Antitoxin |
| - (26093) | 26093..26152 | + | 60 | NuclAT_1 | - | Antitoxin |
| QJR22_RS00245 (26353) | 26353..26685 | - | 333 | WP_152916585.1 | hypothetical protein | - |
| QJR22_RS00250 (26747) | 26747..27346 | - | 600 | WP_032083981.1 | PIN domain-containing protein | - |
| QJR22_RS00255 (27732) | 27732..27932 | - | 201 | WP_015059022.1 | hypothetical protein | - |
| QJR22_RS00260 (28064) | 28064..28624 | - | 561 | WP_000139328.1 | fertility inhibition protein FinO | - |
| QJR22_RS00265 (28679) | 28679..29425 | - | 747 | WP_000205770.1 | conjugal transfer pilus acetylase TraX | - |
| QJR22_RS00270 (29445) | 29445..29645 | - | 201 | WP_072354025.1 | hypothetical protein | - |
| QJR22_RS00275 (29670) | 29670..30374 | + | 705 | WP_001067855.1 | IS6-like element IS26 family transposase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Non-Mobilizable plasmid | rmtB / blaTEM-1B / blaSHV-12 | - | 1..50524 | 50524 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 50 a.a. Molecular weight: 5542.67 Da Isoelectric Point: 8.7678
>T282056 WP_001312851.1 NZ_CP125346:c26048-25899 [Klebsiella pneumoniae]
MTKYALIGLLAVCATVLCFSLIFRERLCELNIHRGNTVVQVTLAYEARK
MTKYALIGLLAVCATVLCFSLIFRERLCELNIHRGNTVVQVTLAYEARK
Download Length: 150 bp
Antitoxin
Download Length: 60 bp
>AT282056 NZ_CP125346:26093-26152 [Klebsiella pneumoniae]
TAAGTACTTCATGCAGACCTCACGAGTTAATGGATTAACGAGTGGGGTCTTCGCATTTCT
TAAGTACTTCATGCAGACCTCACGAGTTAATGGATTAACGAGTGGGGTCTTCGCATTTCT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|