Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | tacAT/DUF1778(antitoxin) |
Location | 743821..744596 | Replicon | chromosome |
Accession | NZ_CP125343 | ||
Organism | Klebsiella pneumoniae strain WYKP589 |
Toxin (Protein)
Gene name | TacT2 | Uniprot ID | A0A1Q4Q548 |
Locus tag | QJR23_RS05070 | Protein ID | WP_004150910.1 |
Coordinates | 744111..744596 (+) | Length | 162 a.a. |
Antitoxin (Protein)
Gene name | TacA2 | Uniprot ID | W8UEW1 |
Locus tag | QJR23_RS05065 | Protein ID | WP_004150912.1 |
Coordinates | 743821..744114 (+) | Length | 98 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QJR23_RS05045 (QJR23_05045) | 739029..739631 | - | 603 | WP_062954968.1 | short chain dehydrogenase | - |
QJR23_RS05050 (QJR23_05050) | 739729..740640 | + | 912 | WP_004188550.1 | LysR family transcriptional regulator | - |
QJR23_RS05055 (QJR23_05055) | 740641..741789 | - | 1149 | WP_004150915.1 | PLP-dependent aspartate aminotransferase family protein | - |
QJR23_RS05060 (QJR23_05060) | 741800..743176 | - | 1377 | WP_004217775.1 | cystathionine beta-synthase | - |
QJR23_RS05065 (QJR23_05065) | 743821..744114 | + | 294 | WP_004150912.1 | DUF1778 domain-containing protein | Antitoxin |
QJR23_RS05070 (QJR23_05070) | 744111..744596 | + | 486 | WP_004150910.1 | GNAT family N-acetyltransferase | Toxin |
QJR23_RS05075 (QJR23_05075) | 745300..745893 | + | 594 | WP_004188553.1 | hypothetical protein | - |
QJR23_RS05080 (QJR23_05080) | 745990..746206 | + | 217 | Protein_733 | transposase | - |
QJR23_RS05085 (QJR23_05085) | 746812..747684 | + | 873 | WP_004188557.1 | ParA family protein | - |
QJR23_RS05090 (QJR23_05090) | 747684..748067 | + | 384 | WP_004150906.1 | hypothetical protein | - |
QJR23_RS05095 (QJR23_05095) | 748060..749427 | + | 1368 | WP_004150905.1 | SPI-7-type island replicative DNA helicase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
flank | IS/Tn | - | - | 745990..746142 | 152 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 162 a.a. Molecular weight: 17551.59 Da Isoelectric Point: 8.8818
>T282040 WP_004150910.1 NZ_CP125343:744111-744596 [Klebsiella pneumoniae]
MISAPEPLHAGHILTPFCCGIDSMDHWLKQRAMKNQVTGASRTFVCCDDAKVMAYYSLASSAVTTNTAPGRFRRNMPAPI
PVVVLGRLAVDKSLHGKGVGRALVRDAGLRVIQVAETIGIRGMLVHALSDEARDFYLRVGFEPSPMDPMMLMVTLRDLVN
A
MISAPEPLHAGHILTPFCCGIDSMDHWLKQRAMKNQVTGASRTFVCCDDAKVMAYYSLASSAVTTNTAPGRFRRNMPAPI
PVVVLGRLAVDKSLHGKGVGRALVRDAGLRVIQVAETIGIRGMLVHALSDEARDFYLRVGFEPSPMDPMMLMVTLRDLVN
A
Download Length: 486 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A1Q4Q548 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0H3GVL4 |