Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | hok-sok/- |
| Location | 57699..57952 | Replicon | plasmid pWYKP589-2 |
| Accession | NZ_CP125342 | ||
| Organism | Klebsiella pneumoniae strain WYKP589 | ||
Toxin (Protein)
| Gene name | srnB | Uniprot ID | G9G1E3 |
| Locus tag | QJR23_RS00960 | Protein ID | WP_001312851.1 |
| Coordinates | 57699..57848 (-) | Length | 50 a.a. |
Antitoxin (RNA)
| Gene name | srnC | ||
| Locus tag | - | ||
| Coordinates | 57893..57952 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QJR23_RS00925 (53058) | 53058..53473 | - | 416 | Protein_68 | IS1-like element IS1B family transposase | - |
| QJR23_RS00930 (53722) | 53722..54123 | - | 402 | WP_001398199.1 | type II toxin-antitoxin system toxin endoribonuclease PemK | - |
| QJR23_RS00935 (54056) | 54056..54313 | - | 258 | WP_000557619.1 | type II toxin-antitoxin system antitoxin PemI | - |
| QJR23_RS00940 (54406) | 54406..55059 | - | 654 | WP_000616807.1 | CPBP family intramembrane metalloprotease | - |
| QJR23_RS00945 (55998) | 55998..56855 | - | 858 | WP_032495102.1 | incFII family plasmid replication initiator RepA | - |
| QJR23_RS00950 (56848) | 56848..56922 | - | 75 | WP_001375168.1 | RepA leader peptide Tap | - |
| QJR23_RS00955 (57167) | 57167..57415 | - | 249 | WP_000083837.1 | replication regulatory protein RepA | - |
| QJR23_RS00960 (57699) | 57699..57848 | - | 150 | WP_001312851.1 | Hok/Gef family protein | Toxin |
| - (57893) | 57893..57952 | + | 60 | NuclAT_1 | - | Antitoxin |
| - (57893) | 57893..57952 | + | 60 | NuclAT_1 | - | Antitoxin |
| - (57893) | 57893..57952 | + | 60 | NuclAT_1 | - | Antitoxin |
| - (57893) | 57893..57952 | + | 60 | NuclAT_1 | - | Antitoxin |
| QJR23_RS00965 (58153) | 58153..58485 | - | 333 | WP_152916585.1 | hypothetical protein | - |
| QJR23_RS00970 (58547) | 58547..59146 | - | 600 | WP_032083981.1 | PIN domain-containing protein | - |
| QJR23_RS00975 (59532) | 59532..59732 | - | 201 | WP_015059022.1 | hypothetical protein | - |
| QJR23_RS00980 (59864) | 59864..60424 | - | 561 | WP_000139328.1 | fertility inhibition protein FinO | - |
| QJR23_RS00985 (60479) | 60479..61225 | - | 747 | WP_000205770.1 | conjugal transfer pilus acetylase TraX | - |
| QJR23_RS00990 (61245) | 61245..61445 | - | 201 | WP_072354025.1 | hypothetical protein | - |
| QJR23_RS00995 (61470) | 61470..62174 | + | 705 | WP_001067855.1 | IS6-like element IS26 family transposase | - |
| QJR23_RS01000 (62226) | 62226..62570 | + | 345 | Protein_83 | IS6-like element IS26 family transposase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Non-Mobilizable plasmid | blaKPC-2 / blaSHV-12 / rmtB / blaTEM-1B | - | 1..110599 | 110599 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 50 a.a. Molecular weight: 5542.67 Da Isoelectric Point: 8.7678
>T282033 WP_001312851.1 NZ_CP125342:c57848-57699 [Klebsiella pneumoniae]
MTKYALIGLLAVCATVLCFSLIFRERLCELNIHRGNTVVQVTLAYEARK
MTKYALIGLLAVCATVLCFSLIFRERLCELNIHRGNTVVQVTLAYEARK
Download Length: 150 bp
Antitoxin
Download Length: 60 bp
>AT282033 NZ_CP125342:57893-57952 [Klebsiella pneumoniae]
TAAGTACTTCATGCAGACCTCACGAGTTAATGGATTAACGAGTGGGGTCTTCGCATTTCT
TAAGTACTTCATGCAGACCTCACGAGTTAATGGATTAACGAGTGGGGTCTTCGCATTTCT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
