Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | hok-sok/- |
| Location | 76331..76584 | Replicon | plasmid pWYKP586-2 |
| Accession | NZ_CP125336 | ||
| Organism | Klebsiella pneumoniae strain WYKP586 | ||
Toxin (Protein)
| Gene name | srnB | Uniprot ID | G9G1E3 |
| Locus tag | QJR21_RS29180 | Protein ID | WP_001312851.1 |
| Coordinates | 76435..76584 (+) | Length | 50 a.a. |
Antitoxin (RNA)
| Gene name | srnC | ||
| Locus tag | - | ||
| Coordinates | 76331..76390 (-) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QJR21_RS29140 (71713) | 71713..72057 | - | 345 | Protein_98 | IS6-like element IS26 family transposase | - |
| QJR21_RS29145 (72109) | 72109..72813 | - | 705 | WP_001067855.1 | IS6-like element IS26 family transposase | - |
| QJR21_RS29150 (72838) | 72838..73038 | + | 201 | WP_072354025.1 | hypothetical protein | - |
| QJR21_RS29155 (73058) | 73058..73804 | + | 747 | WP_000205770.1 | conjugal transfer pilus acetylase TraX | - |
| QJR21_RS29160 (73859) | 73859..74419 | + | 561 | WP_000139328.1 | fertility inhibition protein FinO | - |
| QJR21_RS29165 (74551) | 74551..74751 | + | 201 | WP_015059022.1 | hypothetical protein | - |
| QJR21_RS29170 (75137) | 75137..75736 | + | 600 | WP_032083981.1 | PIN domain-containing protein | - |
| QJR21_RS29175 (75798) | 75798..76130 | + | 333 | WP_152916585.1 | hypothetical protein | - |
| - (76331) | 76331..76390 | - | 60 | NuclAT_0 | - | Antitoxin |
| - (76331) | 76331..76390 | - | 60 | NuclAT_0 | - | Antitoxin |
| - (76331) | 76331..76390 | - | 60 | NuclAT_0 | - | Antitoxin |
| - (76331) | 76331..76390 | - | 60 | NuclAT_0 | - | Antitoxin |
| QJR21_RS29180 (76435) | 76435..76584 | + | 150 | WP_001312851.1 | Hok/Gef family protein | Toxin |
| QJR21_RS29185 (76868) | 76868..77116 | + | 249 | WP_000083837.1 | replication regulatory protein RepA | - |
| QJR21_RS29190 (77361) | 77361..77435 | + | 75 | WP_001375168.1 | RepA leader peptide Tap | - |
| QJR21_RS29195 (77428) | 77428..78285 | + | 858 | WP_032495102.1 | incFII family plasmid replication initiator RepA | - |
| QJR21_RS29200 (79224) | 79224..79877 | + | 654 | WP_000616807.1 | CPBP family intramembrane metalloprotease | - |
| QJR21_RS29205 (79970) | 79970..80227 | + | 258 | WP_000557619.1 | type II toxin-antitoxin system antitoxin PemI | - |
| QJR21_RS29210 (80160) | 80160..80561 | + | 402 | WP_001398199.1 | type II toxin-antitoxin system toxin endoribonuclease PemK | - |
| QJR21_RS29215 (80810) | 80810..81225 | + | 416 | Protein_113 | IS1-like element IS1B family transposase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Non-Mobilizable plasmid | blaSHV-12 / blaKPC-2 | - | 1..110449 | 110449 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 50 a.a. Molecular weight: 5542.67 Da Isoelectric Point: 8.7678
>T282023 WP_001312851.1 NZ_CP125336:76435-76584 [Klebsiella pneumoniae]
MTKYALIGLLAVCATVLCFSLIFRERLCELNIHRGNTVVQVTLAYEARK
MTKYALIGLLAVCATVLCFSLIFRERLCELNIHRGNTVVQVTLAYEARK
Download Length: 150 bp
Antitoxin
Download Length: 60 bp
>AT282023 NZ_CP125336:c76390-76331 [Klebsiella pneumoniae]
TAAGTACTTCATGCAGACCTCACGAGTTAATGGATTAACGAGTGGGGTCTTCGCATTTCT
TAAGTACTTCATGCAGACCTCACGAGTTAATGGATTAACGAGTGGGGTCTTCGCATTTCT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
