Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/HigB-HigA |
| Location | 39631..40358 | Replicon | plasmid unnamed1 |
| Accession | NZ_CP125335 | ||
| Organism | Klebsiella pneumoniae strain WYKP586 | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | A0A7W3D9W1 |
| Locus tag | QJR21_RS27200 | Protein ID | WP_011251285.1 |
| Coordinates | 39631..39942 (+) | Length | 104 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | - |
| Locus tag | QJR21_RS27205 | Protein ID | WP_011251286.1 |
| Coordinates | 39939..40358 (+) | Length | 140 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QJR21_RS27160 (QJR21_27160) | 34642..35136 | + | 495 | WP_011251274.1 | hypothetical protein | - |
| QJR21_RS27165 (QJR21_27165) | 35142..35582 | + | 441 | WP_011251275.1 | hypothetical protein | - |
| QJR21_RS27170 (QJR21_27170) | 36007..36963 | - | 957 | WP_011251280.1 | DsbA family protein | - |
| QJR21_RS27175 (QJR21_27175) | 37023..37364 | - | 342 | WP_011251281.1 | hypothetical protein | - |
| QJR21_RS27180 (QJR21_27180) | 37378..37689 | - | 312 | WP_011251282.1 | hypothetical protein | - |
| QJR21_RS27185 (QJR21_27185) | 37706..38155 | - | 450 | WP_011251283.1 | thioredoxin fold domain-containing protein | - |
| QJR21_RS27195 (QJR21_27195) | 38989..39426 | + | 438 | Protein_39 | DDE-type integrase/transposase/recombinase | - |
| QJR21_RS27200 (QJR21_27200) | 39631..39942 | + | 312 | WP_011251285.1 | type II toxin-antitoxin system HigB family toxin | Toxin |
| QJR21_RS27205 (QJR21_27205) | 39939..40358 | + | 420 | WP_011251286.1 | helix-turn-helix domain-containing protein | Antitoxin |
| QJR21_RS27210 (QJR21_27210) | 40505..41473 | + | 969 | WP_074428168.1 | IS5 family transposase | - |
| QJR21_RS27215 (QJR21_27215) | 41545..41910 | - | 366 | WP_048333448.1 | hypothetical protein | - |
| QJR21_RS27220 (QJR21_27220) | 41924..42712 | - | 789 | WP_040217257.1 | hypothetical protein | - |
| QJR21_RS27225 (QJR21_27225) | 42733..43353 | - | 621 | WP_223175004.1 | conjugative transfer protein MobI(A/C) | - |
| QJR21_RS27230 (QJR21_27230) | 43772..44407 | + | 636 | WP_223171879.1 | hypothetical protein | - |
| QJR21_RS27235 (QJR21_27235) | 44720..45190 | + | 471 | WP_048333570.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Conjugative plasmid | catA2 / sul2 / tet(A) / blaLAP-2 / qnrS1 | rmpA2 / iutA / iucD / iucC / iucB / iucA / rmpA / iroN | 1..302246 | 302246 | |
| - | inside | IScluster/Tn | - | - | 32722..57029 | 24307 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 104 a.a. Molecular weight: 12346.12 Da Isoelectric Point: 9.7248
>T282019 WP_011251285.1 NZ_CP125335:39631-39942 [Klebsiella pneumoniae]
MHVISKEPFEEAAKRYPNDSLAIRALYRLVRETDFSSPAEMLTLIPSLDNFKYRNKWWVLDVGGNNLRVIAYINFVNKRF
YVKHIATHADYDKLTRYYRENKE
MHVISKEPFEEAAKRYPNDSLAIRALYRLVRETDFSSPAEMLTLIPSLDNFKYRNKWWVLDVGGNNLRVIAYINFVNKRF
YVKHIATHADYDKLTRYYRENKE
Download Length: 312 bp
Antitoxin
Download Length: 140 a.a. Molecular weight: 15377.46 Da Isoelectric Point: 4.4420
>AT282019 WP_011251286.1 NZ_CP125335:39939-40358 [Klebsiella pneumoniae]
MITDTAKAIEATKQLVAAVPFLGGSSSESDYREAMELVDYLIENDDENPLIDFLASKIADYEDNSPRFAEFNKAIAEIPV
GVALLRTLIDQHKLSYSDLKDEIGSKSLVSQILSGQRSLTITHIKALSARFGVKPEWFL
MITDTAKAIEATKQLVAAVPFLGGSSSESDYREAMELVDYLIENDDENPLIDFLASKIADYEDNSPRFAEFNKAIAEIPV
GVALLRTLIDQHKLSYSDLKDEIGSKSLVSQILSGQRSLTITHIKALSARFGVKPEWFL
Download Length: 420 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|