Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) phd-doc/Doc-RelB
Location 322362..322948 Replicon chromosome
Accession NZ_CP125334
Organism Klebsiella pneumoniae strain WYKP586

Toxin (Protein)


Gene name doc Uniprot ID W8VD46
Locus tag QJR21_RS01500 Protein ID WP_002920800.1
Coordinates 322580..322948 (+) Length 123 a.a.

Antitoxin (Protein)


Gene name phd Uniprot ID A0A0H3GZM4
Locus tag QJR21_RS01495 Protein ID WP_002920802.1
Coordinates 322362..322583 (+) Length 74 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
QJR21_RS01475 (QJR21_01475) 318519..319445 + 927 WP_002920807.1 high-affinity branched-chain amino acid ABC transporter permease LivH -
QJR21_RS01480 (QJR21_01480) 319442..320719 + 1278 WP_217289780.1 high-affinity branched-chain amino acid ABC transporter permease LivM -
QJR21_RS01485 (QJR21_01485) 320716..321483 + 768 WP_002920803.1 high-affinity branched-chain amino acid ABC transporter ATP-binding protein LivG -
QJR21_RS01490 (QJR21_01490) 321485..322198 + 714 WP_004145133.1 high-affinity branched-chain amino acid ABC transporter ATP-binding protein LivF -
QJR21_RS01495 (QJR21_01495) 322362..322583 + 222 WP_002920802.1 type II toxin-antitoxin system Phd/YefM family antitoxin Antitoxin
QJR21_RS01500 (QJR21_01500) 322580..322948 + 369 WP_002920800.1 type II toxin-antitoxin system death-on-curing family toxin Toxin
QJR21_RS01505 (QJR21_01505) 323221..324537 + 1317 WP_002920796.1 sn-glycerol-3-phosphate ABC transporter substrate-binding protein UgpB -
QJR21_RS01510 (QJR21_01510) 324644..325531 + 888 WP_002920792.1 sn-glycerol-3-phosphate ABC transporter permease UgpA -
QJR21_RS01515 (QJR21_01515) 325528..326373 + 846 WP_002920789.1 sn-glycerol-3-phosphate ABC transporter permease UgpE -
QJR21_RS01520 (QJR21_01520) 326375..327445 + 1071 WP_002920787.1 sn-glycerol-3-phosphate import ATP-binding protein UgpC -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
inside Prophage - - 319442..328182 8740


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Fido domain

(13-86)

Antitoxin

Type II toxin-antitoxin system, antitoxin Phd/YefM

(1-49)


Sequences

Toxin        


Download         Length: 123 a.a.        Molecular weight: 13552.92 Da        Isoelectric Point: 8.6410

>T282005 WP_002920800.1 NZ_CP125334:322580-322948 [Klebsiella pneumoniae]
MTLQIISAEEIIQFHDRLLRVTPGVAGMPDPGRAEAIMYRVLNKIEYEGVTDVWRLAAMHLLAISRGHIFNDGNKRTALF
ITLLFLKRNGIILPANPDFVGMTVEAAAGQLTLEQIVARLRG

Download         Length: 369 bp

Antitoxin


Download         Length: 74 a.a.        Molecular weight: 8181.18 Da        Isoelectric Point: 4.7769

>AT282005 WP_002920802.1 NZ_CP125334:322362-322583 [Klebsiella pneumoniae]
MRTVNYSEARQNLADVLESAVTGVPVTITRRGHKSAVIISAEEFERYQTARMDDEFAAIMAVHGDEIRELADK

Download         Length: 222 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A0H3GUD1

Antitoxin

Source ID Structure
AlphaFold DB A0A0H3GZM4

References