Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | DinJ-YafQ (relBE)/YafQ-DinJ |
Location | 446367..446910 | Replicon | chromosome |
Accession | NZ_CP125315 | ||
Organism | Lacticaseibacillus rhamnosus strain k32 |
Toxin (Protein)
Gene name | yafQ | Uniprot ID | - |
Locus tag | QJQ50_RS02105 | Protein ID | WP_032965546.1 |
Coordinates | 446367..446654 (-) | Length | 96 a.a. |
Antitoxin (Protein)
Gene name | dinJ | Uniprot ID | - |
Locus tag | QJQ50_RS02110 | Protein ID | WP_032965544.1 |
Coordinates | 446638..446910 (-) | Length | 91 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QJQ50_RS02075 (QJQ50_02075) | 441500..441868 | - | 369 | WP_032965551.1 | dihydroxyacetone kinase phosphoryl donor subunit DhaM | - |
QJQ50_RS02080 (QJQ50_02080) | 442017..442598 | - | 582 | WP_005691622.1 | dihydroxyacetone kinase subunit DhaL | - |
QJQ50_RS02085 (QJQ50_02085) | 442585..443604 | - | 1020 | WP_048482627.1 | dihydroxyacetone kinase subunit DhaK | - |
QJQ50_RS02090 (QJQ50_02090) | 443798..444226 | - | 429 | WP_005691626.1 | OsmC family protein | - |
QJQ50_RS02095 (QJQ50_02095) | 444337..444516 | - | 180 | WP_032965548.1 | hypothetical protein | - |
QJQ50_RS02100 (QJQ50_02100) | 444734..446143 | - | 1410 | WP_032965547.1 | 3'-5' exonuclease | - |
QJQ50_RS02105 (QJQ50_02105) | 446367..446654 | - | 288 | WP_032965546.1 | type II toxin-antitoxin system YafQ family toxin | Toxin |
QJQ50_RS02110 (QJQ50_02110) | 446638..446910 | - | 273 | WP_032965544.1 | type II toxin-antitoxin system RelB/DinJ family antitoxin | Antitoxin |
QJQ50_RS02115 (QJQ50_02115) | 447024..447317 | + | 294 | WP_005684269.1 | metalloregulator ArsR/SmtB family transcription factor | - |
QJQ50_RS02120 (QJQ50_02120) | 447399..448562 | + | 1164 | WP_032965542.1 | MFS transporter | - |
QJQ50_RS02125 (QJQ50_02125) | 448716..449291 | + | 576 | WP_283146272.1 | DNA-3-methyladenine glycosylase I | - |
QJQ50_RS02130 (QJQ50_02130) | 449412..449630 | + | 219 | WP_032965537.1 | hypothetical protein | - |
QJQ50_RS02135 (QJQ50_02135) | 449759..450640 | - | 882 | WP_005684263.1 | class II fructose-1,6-bisphosphate aldolase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 96 a.a. Molecular weight: 10869.72 Da Isoelectric Point: 10.6953
>T282001 WP_032965546.1 NZ_CP125315:c446654-446367 [Lacticaseibacillus rhamnosus]
MMLTINRTRTFKRQFKHLLRQGKDMTKLATAIDTLQRQDRVKLASLHDHALKGAHSGERALHVAPDWLLVYKVDAEALIL
MLLATGTHRDTLNIE
MMLTINRTRTFKRQFKHLLRQGKDMTKLATAIDTLQRQDRVKLASLHDHALKGAHSGERALHVAPDWLLVYKVDAEALIL
MLLATGTHRDTLNIE
Download Length: 288 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|