Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | hok-sok/- |
| Location | 37746..37999 | Replicon | plasmid pCF5125-4 |
| Accession | NZ_CP125314 | ||
| Organism | Citrobacter freundii strain CF5125 | ||
Toxin (Protein)
| Gene name | srnB | Uniprot ID | G9G1E3 |
| Locus tag | QKW62_RS27980 | Protein ID | WP_001312851.1 |
| Coordinates | 37746..37895 (-) | Length | 50 a.a. |
Antitoxin (RNA)
| Gene name | srnC | ||
| Locus tag | - | ||
| Coordinates | 37940..37999 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QKW62_RS27945 (33105) | 33105..33520 | - | 416 | Protein_47 | IS1-like element IS1B family transposase | - |
| QKW62_RS27950 (33769) | 33769..34170 | - | 402 | WP_001398199.1 | type II toxin-antitoxin system toxin endoribonuclease PemK | - |
| QKW62_RS27955 (34103) | 34103..34360 | - | 258 | WP_000557619.1 | type II toxin-antitoxin system antitoxin PemI | - |
| QKW62_RS27960 (34453) | 34453..35106 | - | 654 | WP_000616807.1 | CPBP family intramembrane metalloprotease | - |
| QKW62_RS27965 (36045) | 36045..36902 | - | 858 | WP_032495102.1 | incFII family plasmid replication initiator RepA | - |
| QKW62_RS27970 (36895) | 36895..36969 | - | 75 | WP_001375168.1 | RepA leader peptide Tap | - |
| QKW62_RS27975 (37214) | 37214..37462 | - | 249 | WP_000083837.1 | replication regulatory protein RepA | - |
| QKW62_RS27980 (37746) | 37746..37895 | - | 150 | WP_001312851.1 | Hok/Gef family protein | Toxin |
| - (37940) | 37940..37999 | + | 60 | NuclAT_1 | - | Antitoxin |
| - (37940) | 37940..37999 | + | 60 | NuclAT_1 | - | Antitoxin |
| - (37940) | 37940..37999 | + | 60 | NuclAT_1 | - | Antitoxin |
| - (37940) | 37940..37999 | + | 60 | NuclAT_1 | - | Antitoxin |
| QKW62_RS27985 (38200) | 38200..38532 | - | 333 | WP_152916585.1 | hypothetical protein | - |
| QKW62_RS27990 (38594) | 38594..39193 | - | 600 | WP_032083981.1 | PIN domain-containing protein | - |
| QKW62_RS27995 (39579) | 39579..39779 | - | 201 | WP_015059022.1 | hypothetical protein | - |
| QKW62_RS28000 (39911) | 39911..40471 | - | 561 | WP_000139328.1 | fertility inhibition protein FinO | - |
| QKW62_RS28005 (40526) | 40526..41272 | - | 747 | WP_000205770.1 | conjugal transfer pilus acetylase TraX | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Conjugative plasmid | rmtB / blaTEM-1B / fosA3 | - | 1..71751 | 71751 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 50 a.a. Molecular weight: 5542.67 Da Isoelectric Point: 8.7678
>T281997 WP_001312851.1 NZ_CP125314:c37895-37746 [Citrobacter freundii]
MTKYALIGLLAVCATVLCFSLIFRERLCELNIHRGNTVVQVTLAYEARK
MTKYALIGLLAVCATVLCFSLIFRERLCELNIHRGNTVVQVTLAYEARK
Download Length: 150 bp
Antitoxin
Download Length: 60 bp
>AT281997 NZ_CP125314:37940-37999 [Citrobacter freundii]
TAAGTACTTCATGCAGACCTCACGAGTTAATGGATTAACGAGTGGGGTCTTCGCATTTCT
TAAGTACTTCATGCAGACCTCACGAGTTAATGGATTAACGAGTGGGGTCTTCGCATTTCT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
