Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | bsrG-as-bsrG/- |
| Location | 4110756..4111018 | Replicon | chromosome |
| Accession | NZ_CP125292 | ||
| Organism | Bacillus subtilis strain SRCM117797 | ||
Toxin (Protein)
| Gene name | bsrG | Uniprot ID | L8EAY0 |
| Locus tag | QL281_RS21885 | Protein ID | WP_009967548.1 |
| Coordinates | 4110902..4111018 (-) | Length | 39 a.a. |
Antitoxin (RNA)
| Gene name | as-bsrG | ||
| Locus tag | - | ||
| Coordinates | 4110756..4110907 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QL281_RS21855 (4105928) | 4105928..4106461 | + | 534 | WP_041336408.1 | SMI1/KNR4 family protein | - |
| QL281_RS21860 (4106594) | 4106594..4108396 | + | 1803 | WP_041336409.1 | LXG family T7SS effector ribonuclease toxin YobL | - |
| QL281_RS21865 (4108406) | 4108406..4108864 | + | 459 | WP_041336410.1 | type VII secretion system immunity protein YobK | - |
| QL281_RS21870 (4108954) | 4108954..4109412 | + | 459 | WP_014479998.1 | YrhA family protein | - |
| QL281_RS21875 (4109468) | 4109468..4110022 | + | 555 | WP_041336412.1 | SMI1/KNR4 family protein | - |
| QL281_RS21880 (4110082) | 4110082..4110615 | + | 534 | WP_014479996.1 | GNAT family protein | - |
| - (4110756) | 4110756..4110907 | + | 152 | NuclAT_0 | - | Antitoxin |
| - (4110756) | 4110756..4110907 | + | 152 | NuclAT_0 | - | Antitoxin |
| - (4110756) | 4110756..4110907 | + | 152 | NuclAT_0 | - | Antitoxin |
| - (4110756) | 4110756..4110907 | + | 152 | NuclAT_0 | - | Antitoxin |
| QL281_RS21885 (4110902) | 4110902..4111018 | - | 117 | WP_009967548.1 | type I toxin-antitoxin system toxin BsrG | Toxin |
| QL281_RS21890 (4111250) | 4111250..4111717 | + | 468 | WP_041336414.1 | YolA family protein | - |
| QL281_RS21895 (4111723) | 4111723..4112079 | + | 357 | WP_041336416.1 | hypothetical protein | - |
| QL281_RS21900 (4112199) | 4112199..4113446 | + | 1248 | WP_031600262.1 | IS256-like element ISBsu2 family transposase | - |
| QL281_RS21905 (4113499) | 4113499..4113834 | - | 336 | WP_041336417.1 | hypothetical protein | - |
| QL281_RS21910 (4114007) | 4114007..4114339 | + | 333 | WP_041336419.1 | YolD-like family protein | - |
| QL281_RS21915 (4114332) | 4114332..4115585 | + | 1254 | WP_283009946.1 | UV damage repair protein UvrX | - |
| QL281_RS21920 (4115687) | 4115687..4116004 | + | 318 | WP_009967545.1 | sublancin immunity protein SunI | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Genomic island | - | - | 4101997..4124970 | 22973 | |
| - | flank | IS/Tn | - | - | 4112208..4113446 | 1238 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 39 a.a. Molecular weight: 4336.39 Da Isoelectric Point: 10.1022
>T281969 WP_009967548.1 NZ_CP125292:c4111018-4110902 [Bacillus subtilis]
MTVYESLMIMINFGGLILNTVLLIFNIMMIVTSSQKKK
MTVYESLMIMINFGGLILNTVLLIFNIMMIVTSSQKKK
Download Length: 117 bp
Antitoxin
Download Length: 152 bp
>AT281969 NZ_CP125292:4110756-4110907 [Bacillus subtilis]
TTTCTTTAATGAGAAATGCATAAAATAAAAAGACCAGGGTGTTGGCGCACCCCGGCTCTGTACAAAAAGCTGCCCGTCAA
AGGGCTTGCTCGATGTTCAATCTGCGTAGACCTAACCCTTTAAGGTTCCTAAGCTCAAGGGAAGGTCTATTT
TTTCTTTAATGAGAAATGCATAAAATAAAAAGACCAGGGTGTTGGCGCACCCCGGCTCTGTACAAAAAGCTGCCCGTCAA
AGGGCTTGCTCGATGTTCAATCTGCGTAGACCTAACCCTTTAAGGTTCCTAAGCTCAAGGGAAGGTCTATTT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
