Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/HigB-VapI |
Location | 5371254..5371849 | Replicon | chromosome |
Accession | NZ_CP125288 | ||
Organism | Pseudomonas aeruginosa strain SF416 |
Toxin (Protein)
Gene name | higB | Uniprot ID | A0A241XLJ5 |
Locus tag | QLX61_RS24735 | Protein ID | WP_003117425.1 |
Coordinates | 5371571..5371849 (-) | Length | 93 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | - |
Locus tag | QLX61_RS24730 | Protein ID | WP_003113527.1 |
Coordinates | 5371254..5371559 (-) | Length | 102 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QLX61_RS24695 (QLX61_24690) | 5366393..5367241 | + | 849 | WP_003099284.1 | 4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase | - |
QLX61_RS24705 (QLX61_24700) | 5367408..5368349 | + | 942 | WP_003099281.1 | ribose-phosphate pyrophosphokinase | - |
QLX61_RS24710 (QLX61_24705) | 5368466..5369080 | + | 615 | WP_003099279.1 | 50S ribosomal protein L25/general stress protein Ctc | - |
QLX61_RS24715 (QLX61_24710) | 5369122..5369706 | + | 585 | WP_003099278.1 | aminoacyl-tRNA hydrolase | - |
QLX61_RS24720 (QLX61_24715) | 5369747..5370847 | + | 1101 | WP_003099270.1 | redox-regulated ATPase YchF | - |
QLX61_RS24730 (QLX61_24725) | 5371254..5371559 | - | 306 | WP_003113527.1 | HigA family addiction module antitoxin | Antitoxin |
QLX61_RS24735 (QLX61_24730) | 5371571..5371849 | - | 279 | WP_003117425.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
QLX61_RS24740 (QLX61_24735) | 5371902..5372030 | - | 129 | Protein_4886 | integrase | - |
QLX61_RS24745 (QLX61_24740) | 5372178..5374406 | + | 2229 | WP_003113525.1 | TonB-dependent receptor | - |
QLX61_RS24750 (QLX61_24745) | 5374476..5375123 | - | 648 | WP_003095021.1 | carbonate dehydratase | - |
QLX61_RS24755 (QLX61_24750) | 5375185..5376423 | - | 1239 | WP_003113524.1 | dipeptidase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 93 a.a. Molecular weight: 10701.28 Da Isoelectric Point: 8.5576
>T281960 WP_003117425.1 NZ_CP125288:c5371849-5371571 [Pseudomonas aeruginosa]
MILTFRCDETRQLFETGLSRRWGAILTVATRKLAMLHAARELRDLRSPPGNRLEPLQGKRAGQHSIRINDQWRVCFVWTD
AGPEEVEIVDYH
MILTFRCDETRQLFETGLSRRWGAILTVATRKLAMLHAARELRDLRSPPGNRLEPLQGKRAGQHSIRINDQWRVCFVWTD
AGPEEVEIVDYH
Download Length: 279 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|