Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/COG4683-HTH_37 |
Location | 4749483..4750164 | Replicon | chromosome |
Accession | NZ_CP125288 | ||
Organism | Pseudomonas aeruginosa strain SF416 |
Toxin (Protein)
Gene name | higB | Uniprot ID | V6AKP0 |
Locus tag | QLX61_RS21880 | Protein ID | WP_003111825.1 |
Coordinates | 4749799..4750164 (-) | Length | 122 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | - |
Locus tag | QLX61_RS21875 | Protein ID | WP_003145733.1 |
Coordinates | 4749483..4749806 (-) | Length | 108 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QLX61_RS21845 (QLX61_21840) | 4745408..4746046 | + | 639 | WP_003140882.1 | hypothetical protein | - |
QLX61_RS21850 (QLX61_21845) | 4746289..4746624 | + | 336 | WP_003140884.1 | TM2 domain-containing protein | - |
QLX61_RS21855 (QLX61_21850) | 4746798..4747316 | + | 519 | WP_031764395.1 | PAAR domain-containing protein | - |
QLX61_RS21860 (QLX61_21855) | 4747313..4747501 | + | 189 | WP_023090039.1 | hypothetical protein | - |
QLX61_RS21865 (QLX61_21860) | 4747568..4748014 | + | 447 | WP_031764396.1 | VRR-NUC domain-containing protein | - |
QLX61_RS21870 (QLX61_21865) | 4748031..4749119 | + | 1089 | WP_031652783.1 | DUF3396 domain-containing protein | - |
QLX61_RS21875 (QLX61_21870) | 4749483..4749806 | - | 324 | WP_003145733.1 | XRE family transcriptional regulator | Antitoxin |
QLX61_RS21880 (QLX61_21875) | 4749799..4750164 | - | 366 | WP_003111825.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
QLX61_RS21885 (QLX61_21880) | 4750428..4750667 | - | 240 | WP_044060930.1 | hypothetical protein | - |
QLX61_RS21890 (QLX61_21885) | 4750874..4751146 | + | 273 | WP_023090041.1 | hypothetical protein | - |
QLX61_RS21895 (QLX61_21890) | 4751177..4751602 | - | 426 | WP_003114206.1 | VOC family protein | - |
QLX61_RS21900 (QLX61_21895) | 4751703..4752587 | + | 885 | WP_003158600.1 | LysR family transcriptional regulator | - |
QLX61_RS21905 (QLX61_21900) | 4752560..4753513 | - | 954 | WP_003085661.1 | LysR substrate-binding domain-containing protein | - |
QLX61_RS21910 (QLX61_21905) | 4753734..4754168 | + | 435 | WP_003116494.1 | RidA family protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 122 a.a. Molecular weight: 13880.24 Da Isoelectric Point: 4.8219
>T281958 WP_003111825.1 NZ_CP125288:c4750164-4749799 [Pseudomonas aeruginosa]
VAWDIEYTDEFGDWWGSLSEDEQESLAVTVRLLEERGPSLGHPHSSGINGSRHGHMRELRTQHGGRPFRTLYAFDPRRSA
ILLIGGDKTGDDRWYELNVPIADRLYDEHLHQLREEGLIDG
VAWDIEYTDEFGDWWGSLSEDEQESLAVTVRLLEERGPSLGHPHSSGINGSRHGHMRELRTQHGGRPFRTLYAFDPRRSA
ILLIGGDKTGDDRWYELNVPIADRLYDEHLHQLREEGLIDG
Download Length: 366 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|