Detailed information of TA system TA281928

Bioinformatically predicted

Overview

TA module

• Type: I
• Classification (family/domain): hok-sok/-
• Location: 2443773..2443998
• Replicon: chromosome
• Accession: NZ_CP125220
• Organism: Salmonella enterica subsp. enterica serovar Enteritidis strain sm140

Toxin (Protein)

• Gene name: hokW
• Uniprot ID: S1ELB5
• Locus tag: QK897_RS11890
• Protein ID: WP_000813254.1
• Coordinates: 2443773..2443928 (-)
• Length: 52 a.a.

Antitoxin (RNA)

Gene name	sokW
Locus tag	-
Coordinates	2443940..2443998 (+)

Genomic Context

Locus tag	Coordinates	Strand	Size (bp)	Protein ID	Product	Description
QK897_RS11855	2438880..2439161	-	282	WP_000445513.1	phage holin family protein	-
QK897_RS11860	2439151..2439339	-	189	WP_001688615.1	putative holin	-
QK897_RS11865	2439333..2439656	-	324	Protein_2323	tellurite/colicin resistance protein	-
QK897_RS11870	2441827..2442363	-	537	WP_000640113.1	DUF1133 family protein	-
QK897_RS11875	2442360..2442650	-	291	WP_000774470.1	DUF1364 domain-containing protein	-
QK897_RS11880	2442650..2443249	-	600	WP_000940751.1	DUF1367 family protein	-
QK897_RS11885	2443312..2443482	-	171	WP_000734094.1	hypothetical protein	-
QK897_RS11890	2443773..2443928	-	156	WP_000813254.1	type I toxin-antitoxin system toxin HokD	Toxin
-	2443940..2443998	+	59	-	-	Antitoxin
QK897_RS11895	2444355..2445287	+	933	WP_000556390.1	hypothetical protein	-
QK897_RS11900	2445284..2445838	+	555	WP_001033796.1	hypothetical protein	-
QK897_RS11905	2446000..2446329	-	330	WP_001676916.1	DUF977 family protein	-
QK897_RS11910	2446373..2446420	-	48	Protein_2332	hypothetical protein	-
QK897_RS11915	2446602..2447069	+	468	WP_001227859.1	helix-turn-helix domain-containing protein	-
QK897_RS11920	2447454..2447609	+	156	WP_085981757.1	DUF1391 family protein	-
QK897_RS11925	2447717..2448238	-	522	WP_000004762.1	super-infection exclusion protein B	-
QK897_RS11930	2448676..2448897	+	222	WP_000560208.1	cell division protein FtsZ	-

Associated MGEs

MGE detail	Similar MGEs	Relative position	MGE Type	Cargo ARG	Virulence gene	Coordinates	Length (bp)
	-	inside	Prophage	-	-	2438338..2450209	11871

Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.

Domains

Predicted by InterproScan

Toxin

• Hok/gef cell toxic protein (6-47)

Sequences

Toxin

Protein

• Length: 52 a.a.
• Molecular weight: 5736.89 Da
• Isoelectric Point: 6.1531

>T281928 WP_000813254.1 NZ_CP125220:c2443928-2443773 [Salmonella enterica subsp. enterica serovar Enteritidis]
MKQQKAMLIALIVICLTVIVTALVTRKDLCEVRIRTGQTEVAVFTAYEPEE

Nucleotide

• Length: 156 bp

Antitoxin

Nucleotide

• Length: 59 bp

>AT281928 NZ_CP125220:2443940-2443998 [Salmonella enterica subsp. enterica serovar Enteritidis]
CCTTGCCTTTCGGCACGTAAGAGGCTAACCTACATGTGCAAAGCATGAAATTGGCCTCA

Structures

Toxin

• AlphaFold DB: A0A4P7TMW0

Antitoxin