Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vapBC/VapC-VagC |
| Location | 835950..836575 | Replicon | chromosome |
| Accession | NZ_CP125220 | ||
| Organism | Salmonella enterica subsp. enterica serovar Enteritidis strain sm140 | ||
Toxin (Protein)
| Gene name | vapC | Uniprot ID | M7SD17 |
| Locus tag | QK897_RS04030 | Protein ID | WP_000911336.1 |
| Coordinates | 836177..836575 (+) | Length | 133 a.a. |
Antitoxin (Protein)
| Gene name | vapB | Uniprot ID | M7S3S8 |
| Locus tag | QK897_RS04025 | Protein ID | WP_000557549.1 |
| Coordinates | 835950..836177 (+) | Length | 76 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QK897_RS03995 (830958) | 830958..832475 | + | 1518 | WP_000003339.1 | lysine--tRNA ligase | - |
| QK897_RS04000 (832551) | 832551..833096 | - | 546 | WP_000133994.1 | isopentenyl-diphosphate Delta-isomerase | - |
| QK897_RS04005 (833361) | 833361..834119 | + | 759 | WP_000244328.1 | amidase activator ActS | - |
| QK897_RS04015 (834404) | 834404..835210 | - | 807 | WP_001574939.1 | DUF1460 domain-containing protein | - |
| QK897_RS04020 (835490) | 835490..835741 | - | 252 | WP_001576352.1 | hypothetical protein | - |
| QK897_RS04025 (835950) | 835950..836177 | + | 228 | WP_000557549.1 | toxin-antitoxin system antitoxin VapB | Antitoxin |
| QK897_RS04030 (836177) | 836177..836575 | + | 399 | WP_000911336.1 | tRNA(fMet)-specific endonuclease VapC | Toxin |
| QK897_RS04035 (837383) | 837383..837919 | + | 537 | WP_001038502.1 | STM3031 family outer membrane protein | - |
| QK897_RS04040 (837966) | 837966..838598 | + | 633 | WP_000835265.1 | YfdX family protein | - |
| QK897_RS04045 (839317) | 839317..839898 | + | 582 | WP_001244651.1 | fimbrial protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| inside | Genomic island | - | - | 834404..845759 | 11355 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 133 a.a. Molecular weight: 14938.30 Da Isoelectric Point: 7.2155
>T281926 WP_000911336.1 NZ_CP125220:836177-836575 [Salmonella enterica subsp. enterica serovar Enteritidis]
MLKFMLDTNTCIFTIKNKPEHIRERFNLNTSRMCISSITLMELIYGAEKSLAPERNLAVVEGFISRLEVLDYDTQAAIHT
GQIRAELARKGTPVGPYDQMIAGHAGSRGLVVVTNNLREFERIPGIRIEDWC
MLKFMLDTNTCIFTIKNKPEHIRERFNLNTSRMCISSITLMELIYGAEKSLAPERNLAVVEGFISRLEVLDYDTQAAIHT
GQIRAELARKGTPVGPYDQMIAGHAGSRGLVVVTNNLREFERIPGIRIEDWC
Download Length: 399 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| PDB | 6IFC | |
| PDB | 6IFM |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| PDB | 6IFM | |
| AlphaFold DB | A0A3V2Y5V5 |