Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | yefM-yoeB (relBE)/YoeB-RelB |
Location | 2025290..2025877 | Replicon | chromosome |
Accession | NZ_CP125094 | ||
Organism | Agrobacterium fabrum strain N33/94 |
Toxin (Protein)
Gene name | yoeB | Uniprot ID | - |
Locus tag | G6L76_RS09970 | Protein ID | WP_080807502.1 |
Coordinates | 2025290..2025574 (-) | Length | 95 a.a. |
Antitoxin (Protein)
Gene name | yefM | Uniprot ID | - |
Locus tag | G6L76_RS09975 | Protein ID | WP_080807499.1 |
Coordinates | 2025626..2025877 (-) | Length | 84 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
G6L76_RS09945 (G6L76_009945) | 2020769..2021383 | - | 615 | WP_244520223.1 | hypothetical protein | - |
G6L76_RS09950 (G6L76_009950) | 2021570..2022703 | + | 1134 | WP_167305544.1 | alpha-hydroxy acid oxidase | - |
G6L76_RS09955 (G6L76_009955) | 2022900..2023244 | - | 345 | WP_006311727.1 | multidrug efflux SMR transporter | - |
G6L76_RS09960 (G6L76_009960) | 2023241..2023825 | - | 585 | WP_010972227.1 | TetR/AcrR family transcriptional regulator | - |
G6L76_RS09965 (G6L76_009965) | 2024015..2025286 | + | 1272 | WP_167305628.1 | D-alanyl-D-alanine carboxypeptidase | - |
G6L76_RS09970 (G6L76_009970) | 2025290..2025574 | - | 285 | WP_080807502.1 | Txe/YoeB family addiction module toxin | Toxin |
G6L76_RS09975 (G6L76_009975) | 2025626..2025877 | - | 252 | WP_080807499.1 | type II toxin-antitoxin system prevent-host-death family antitoxin | Antitoxin |
G6L76_RS09980 (G6L76_009980) | 2025930..2026679 | - | 750 | WP_080807496.1 | metallophosphoesterase family protein | - |
G6L76_RS09985 (G6L76_009985) | 2026685..2027041 | - | 357 | WP_006311723.1 | hydroxyisourate hydrolase | - |
G6L76_RS09990 (G6L76_009990) | 2027038..2027538 | - | 501 | WP_080807493.1 | ureidoglycolate lyase | - |
G6L76_RS09995 (G6L76_009995) | 2027542..2027904 | - | 363 | WP_010972232.1 | DUF86 domain-containing protein | - |
G6L76_RS10000 (G6L76_010000) | 2027901..2028194 | - | 294 | WP_010972233.1 | nucleotidyltransferase family protein | - |
G6L76_RS10005 (G6L76_010005) | 2028248..2028745 | - | 498 | WP_080807490.1 | 2-oxo-4-hydroxy-4-carboxy-5-ureidoimidazoline decarboxylase | - |
G6L76_RS10010 (G6L76_010010) | 2028745..2029668 | - | 924 | WP_080807485.1 | allantoinase PuuE | - |
G6L76_RS10015 (G6L76_010015) | 2029870..2030577 | - | 708 | WP_080807479.1 | DUF1045 domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 95 a.a. Molecular weight: 11487.22 Da Isoelectric Point: 9.5189
>T281919 WP_080807502.1 NZ_CP125094:c2025574-2025290 [Agrobacterium fabrum]
MQQKGTIALGWSHEGWEDYLHWQKYDRKMLERINELIKDCRRHPFEGIGKPEPLRFQLKGLWSRRISQEHRLVYELRGDG
EKAVLIIHQCRFHY
MQQKGTIALGWSHEGWEDYLHWQKYDRKMLERINELIKDCRRHPFEGIGKPEPLRFQLKGLWSRRISQEHRLVYELRGDG
EKAVLIIHQCRFHY
Download Length: 285 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|