Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | tacAT/DUF1778(antitoxin) |
Location | 5030693..5031468 | Replicon | chromosome |
Accession | NZ_CP125086 | ||
Organism | Klebsiella pneumoniae subsp. pneumoniae strain HVKP2 |
Toxin (Protein)
Gene name | TacT2 | Uniprot ID | B6ZBI6 |
Locus tag | QFB74_RS25425 | Protein ID | WP_004889762.1 |
Coordinates | 5030983..5031468 (+) | Length | 162 a.a. |
Antitoxin (Protein)
Gene name | TacA2 | Uniprot ID | W8UEW1 |
Locus tag | QFB74_RS25420 | Protein ID | WP_004150912.1 |
Coordinates | 5030693..5030986 (+) | Length | 98 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QFB74_RS25400 (5025902) | 5025902..5026504 | - | 603 | WP_002916735.1 | short chain dehydrogenase | - |
QFB74_RS25405 (5026602) | 5026602..5027513 | + | 912 | WP_014906929.1 | LysR family transcriptional regulator | - |
QFB74_RS25410 (5027514) | 5027514..5028662 | - | 1149 | WP_014906930.1 | PLP-dependent aspartate aminotransferase family protein | - |
QFB74_RS25415 (5028673) | 5028673..5030049 | - | 1377 | WP_014906931.1 | pyridoxal-phosphate dependent enzyme | - |
QFB74_RS25420 (5030693) | 5030693..5030986 | + | 294 | WP_004150912.1 | DUF1778 domain-containing protein | Antitoxin |
QFB74_RS25425 (5030983) | 5030983..5031468 | + | 486 | WP_004889762.1 | GNAT family N-acetyltransferase | Toxin |
QFB74_RS25430 (5032172) | 5032172..5032765 | + | 594 | WP_004188553.1 | hypothetical protein | - |
QFB74_RS25435 (5032862) | 5032862..5033078 | + | 217 | Protein_4733 | transposase | - |
QFB74_RS25445 (5033756) | 5033756..5034469 | - | 714 | WP_002916694.1 | DUF554 domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
flank | IS/Tn | - | - | 5032862..5033014 | 152 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 162 a.a. Molecular weight: 17585.56 Da Isoelectric Point: 8.5144
>T281897 WP_004889762.1 NZ_CP125086:5030983-5031468 [Klebsiella pneumoniae subsp. pneumoniae]
MISAPEPLHAGHILTPFCCGIDSMDHWLKQRAMKNQVTGASRTFVCCDDAKVMAYYSLASSAVTTNTAPGRFRRNMPDPI
PVVVLGRLAVDKSLHGKGVGRALVRDAGLRVIQVAETIGIRGMLVHALSDEARDFYLRVGFEPSPMDSMMLMVTLRDLVN
A
MISAPEPLHAGHILTPFCCGIDSMDHWLKQRAMKNQVTGASRTFVCCDDAKVMAYYSLASSAVTTNTAPGRFRRNMPDPI
PVVVLGRLAVDKSLHGKGVGRALVRDAGLRVIQVAETIGIRGMLVHALSDEARDFYLRVGFEPSPMDSMMLMVTLRDLVN
A
Download Length: 486 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A447W563 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0H3GVL4 |