Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) phd-doc/Doc-RelB
Location 4626505..4627091 Replicon chromosome
Accession NZ_CP125086
Organism Klebsiella pneumoniae subsp. pneumoniae strain HVKP2

Toxin (Protein)


Gene name doc Uniprot ID A0A330WAT7
Locus tag QFB74_RS23330 Protein ID WP_014906830.1
Coordinates 4626723..4627091 (+) Length 123 a.a.

Antitoxin (Protein)


Gene name phd Uniprot ID W9B1V1
Locus tag QFB74_RS23325 Protein ID WP_004174006.1
Coordinates 4626505..4626726 (+) Length 74 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
QFB74_RS23305 (4622662) 4622662..4623588 + 927 WP_002920807.1 high-affinity branched-chain amino acid ABC transporter permease LivH -
QFB74_RS23310 (4623585) 4623585..4624862 + 1278 WP_004174005.1 branched chain amino acid ABC transporter permease LivM -
QFB74_RS23315 (4624859) 4624859..4625626 + 768 WP_002920803.1 high-affinity branched-chain amino acid ABC transporter ATP-binding protein LivG -
QFB74_RS23320 (4625628) 4625628..4626341 + 714 WP_004145133.1 high-affinity branched-chain amino acid ABC transporter ATP-binding protein LivF -
QFB74_RS23325 (4626505) 4626505..4626726 + 222 WP_004174006.1 type II toxin-antitoxin system Phd/YefM family antitoxin Antitoxin
QFB74_RS23330 (4626723) 4626723..4627091 + 369 WP_014906830.1 type II toxin-antitoxin system death-on-curing family toxin Toxin
QFB74_RS23335 (4627364) 4627364..4628680 + 1317 WP_004174008.1 sn-glycerol-3-phosphate ABC transporter substrate-binding protein UgpB -
QFB74_RS23340 (4628787) 4628787..4629674 + 888 WP_014906831.1 sn-glycerol-3-phosphate ABC transporter permease UgpA -
QFB74_RS23345 (4629671) 4629671..4630516 + 846 WP_004145129.1 sn-glycerol-3-phosphate ABC transporter permease UgpE -
QFB74_RS23350 (4630518) 4630518..4631588 + 1071 WP_004150074.1 sn-glycerol-3-phosphate import ATP-binding protein UgpC -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
inside Prophage - - 4623585..4632325 8740


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Fido domain

(28-86)

Antitoxin

Type II toxin-antitoxin system, antitoxin Phd/YefM

(1-50)


Sequences

Toxin        


Download         Length: 123 a.a.        Molecular weight: 13537.95 Da        Isoelectric Point: 8.6410

>T281896 WP_014906830.1 NZ_CP125086:4626723-4627091 [Klebsiella pneumoniae subsp. pneumoniae]
MTLQIISAEEIILFHDRLLRVTPGVAGMPDPGRAEAIMYRVLNKIEYEGVTDVWRLAAMHLLAISRGHIFNDGNKRTALF
ITLLFLKRNGIILPANPDFVGMTVEAAAGQLTLEQIVARLRG

Download         Length: 369 bp

Antitoxin


Download         Length: 74 a.a.        Molecular weight: 8151.15 Da        Isoelectric Point: 4.7769

>AT281896 WP_004174006.1 NZ_CP125086:4626505-4626726 [Klebsiella pneumoniae subsp. pneumoniae]
MRTVNYSEARQNLADVLESAVTGVPVTITRRGHKSAVIISAEEFERYQAARMDDEFAAIMAVHGDEIRELADK

Download         Length: 222 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A330WAT7

Antitoxin

Source ID Structure
AlphaFold DB A0A5E5YJY7

References