Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/HigB-HigA |
| Location | 46052..46779 | Replicon | plasmid unnamed |
| Accession | NZ_CP125085 | ||
| Organism | Klebsiella pneumoniae subsp. pneumoniae strain HVKP2 | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | A0A7W3D9W1 |
| Locus tag | QFB74_RS00230 | Protein ID | WP_011251285.1 |
| Coordinates | 46468..46779 (-) | Length | 104 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | - |
| Locus tag | QFB74_RS00225 | Protein ID | WP_011251286.1 |
| Coordinates | 46052..46471 (-) | Length | 140 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QFB74_RS00205 | 41198..44167 | + | 2970 | WP_004213592.1 | Tn3 family transposase | - |
| QFB74_RS00210 | 44209..44703 | + | 495 | WP_004213594.1 | hypothetical protein | - |
| QFB74_RS00215 | 44764..44880 | + | 117 | Protein_42 | Hha/YmoA family nucleoid-associated regulatory protein | - |
| QFB74_RS00220 | 44937..45905 | - | 969 | WP_011251287.1 | IS5 family transposase | - |
| QFB74_RS00225 | 46052..46471 | - | 420 | WP_011251286.1 | helix-turn-helix domain-containing protein | Antitoxin |
| QFB74_RS00230 | 46468..46779 | - | 312 | WP_011251285.1 | type II toxin-antitoxin system HigB family toxin | Toxin |
| QFB74_RS00235 | 46984..47421 | - | 438 | Protein_46 | DDE-type integrase/transposase/recombinase | - |
| QFB74_RS00240 | 47556..48253 | + | 698 | WP_223175001.1 | IS1-like element IS1A family transposase | - |
| QFB74_RS00245 | 48255..48704 | + | 450 | WP_011251283.1 | thioredoxin fold domain-containing protein | - |
| QFB74_RS00250 | 48721..49032 | + | 312 | WP_011251282.1 | hypothetical protein | - |
| QFB74_RS00255 | 49046..49387 | + | 342 | WP_011251281.1 | hypothetical protein | - |
| QFB74_RS00260 | 49447..50403 | + | 957 | WP_011251280.1 | DsbA family protein | - |
| QFB74_RS00265 | 50520..51095 | + | 576 | WP_074424927.1 | hypothetical protein | - |
| QFB74_RS00270 | 51203..51718 | + | 516 | WP_041937820.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Mobilizable plasmid | - | iroB / iroC / iroD / iroN / rmpA / iucA / iucB / iucC / iucD / iutA / rmpA | 1..223890 | 223890 | |
| - | inside | IScluster/Tn | - | - | 40638..48253 | 7615 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 104 a.a. Molecular weight: 12346.12 Da Isoelectric Point: 9.7248
>T281884 WP_011251285.1 NZ_CP125085:c46779-46468 [Klebsiella pneumoniae subsp. pneumoniae]
MHVISKEPFEEAAKRYPNDSLAIRALYRLVRETDFSSPAEMLTLIPSLDNFKYRNKWWVLDVGGNNLRVIAYINFVNKRF
YVKHIATHADYDKLTRYYRENKE
MHVISKEPFEEAAKRYPNDSLAIRALYRLVRETDFSSPAEMLTLIPSLDNFKYRNKWWVLDVGGNNLRVIAYINFVNKRF
YVKHIATHADYDKLTRYYRENKE
Download Length: 312 bp
Antitoxin
Download Length: 140 a.a. Molecular weight: 15377.46 Da Isoelectric Point: 4.4420
>AT281884 WP_011251286.1 NZ_CP125085:c46471-46052 [Klebsiella pneumoniae subsp. pneumoniae]
MITDTAKAIEATKQLVAAVPFLGGSSSESDYREAMELVDYLIENDDENPLIDFLASKIADYEDNSPRFAEFNKAIAEIPV
GVALLRTLIDQHKLSYSDLKDEIGSKSLVSQILSGQRSLTITHIKALSARFGVKPEWFL
MITDTAKAIEATKQLVAAVPFLGGSSSESDYREAMELVDYLIENDDENPLIDFLASKIADYEDNSPRFAEFNKAIAEIPV
GVALLRTLIDQHKLSYSDLKDEIGSKSLVSQILSGQRSLTITHIKALSARFGVKPEWFL
Download Length: 420 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|