Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/COG4683-HTH_37 |
| Location | 4385798..4386444 | Replicon | chromosome |
| Accession | NZ_CP125083 | ||
| Organism | Klebsiella pneumoniae subsp. pneumoniae strain HVKP1 | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | A0A231WWF9 |
| Locus tag | QFB57_RS21865 | Protein ID | WP_004174016.1 |
| Coordinates | 4385798..4386145 (+) | Length | 116 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | - |
| Locus tag | QFB57_RS21870 | Protein ID | WP_223367845.1 |
| Coordinates | 4386199..4386444 (+) | Length | 82 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QFB57_RS21855 (4381724) | 4381724..4383157 | + | 1434 | WP_032445350.1 | glycogen synthase GlgA | - |
| QFB57_RS21860 (4383175) | 4383175..4385622 | + | 2448 | WP_002920561.1 | glycogen phosphorylase | - |
| QFB57_RS21865 (4385798) | 4385798..4386145 | + | 348 | WP_004174016.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| QFB57_RS21870 (4386199) | 4386199..4386444 | + | 246 | WP_223367845.1 | helix-turn-helix transcriptional regulator | Antitoxin |
| QFB57_RS21875 (4386507) | 4386507..4388015 | - | 1509 | WP_019704656.1 | glycerol-3-phosphate dehydrogenase | - |
| QFB57_RS21880 (4388220) | 4388220..4388549 | + | 330 | WP_002920552.1 | thiosulfate sulfurtransferase GlpE | - |
| QFB57_RS21885 (4388600) | 4388600..4389430 | + | 831 | WP_004151408.1 | rhomboid family intramembrane serine protease GlpG | - |
| QFB57_RS21890 (4389480) | 4389480..4390238 | + | 759 | WP_002920548.1 | DeoR/GlpR family transcriptional regulator | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 116 a.a. Molecular weight: 13518.55 Da Isoelectric Point: 6.2327
>T281879 WP_004174016.1 NZ_CP125083:4385798-4386145 [Klebsiella pneumoniae subsp. pneumoniae]
MWDVETTDTFDAWFELQSRALKEDMLATMLILSEFAPQLGRPYVDTVKDSTFQNMKELRVQHHGLPIRAFFAFDPLRKAI
VLCAGNKDGMNEKRFYKEMITLADREFSQHLTKER
MWDVETTDTFDAWFELQSRALKEDMLATMLILSEFAPQLGRPYVDTVKDSTFQNMKELRVQHHGLPIRAFFAFDPLRKAI
VLCAGNKDGMNEKRFYKEMITLADREFSQHLTKER
Download Length: 348 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|