Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) phd-doc/Doc-RelB
Location 4359613..4360199 Replicon chromosome
Accession NZ_CP125083
Organism Klebsiella pneumoniae subsp. pneumoniae strain HVKP1

Toxin (Protein)


Gene name doc Uniprot ID W8VD46
Locus tag QFB57_RS21755 Protein ID WP_002920800.1
Coordinates 4359831..4360199 (+) Length 123 a.a.

Antitoxin (Protein)


Gene name phd Uniprot ID W9B1V1
Locus tag QFB57_RS21750 Protein ID WP_004174006.1
Coordinates 4359613..4359834 (+) Length 74 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
QFB57_RS21730 (4355770) 4355770..4356696 + 927 WP_002920807.1 high-affinity branched-chain amino acid ABC transporter permease LivH -
QFB57_RS21735 (4356693) 4356693..4357970 + 1278 WP_004174005.1 branched chain amino acid ABC transporter permease LivM -
QFB57_RS21740 (4357967) 4357967..4358734 + 768 WP_002920803.1 high-affinity branched-chain amino acid ABC transporter ATP-binding protein LivG -
QFB57_RS21745 (4358736) 4358736..4359449 + 714 WP_004145133.1 high-affinity branched-chain amino acid ABC transporter ATP-binding protein LivF -
QFB57_RS21750 (4359613) 4359613..4359834 + 222 WP_004174006.1 type II toxin-antitoxin system Phd/YefM family antitoxin Antitoxin
QFB57_RS21755 (4359831) 4359831..4360199 + 369 WP_002920800.1 type II toxin-antitoxin system death-on-curing family toxin Toxin
QFB57_RS21760 (4360472) 4360472..4361788 + 1317 WP_004174008.1 sn-glycerol-3-phosphate ABC transporter substrate-binding protein UgpB -
QFB57_RS21765 (4361895) 4361895..4362782 + 888 WP_002920792.1 sn-glycerol-3-phosphate ABC transporter permease UgpA -
QFB57_RS21770 (4362779) 4362779..4363624 + 846 WP_004174009.1 sn-glycerol-3-phosphate ABC transporter permease UgpE -
QFB57_RS21775 (4363626) 4363626..4364696 + 1071 WP_032445345.1 sn-glycerol-3-phosphate import ATP-binding protein UgpC -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
inside Prophage - - 4356693..4365433 8740


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Fido domain

(13-86)

Antitoxin

Type II toxin-antitoxin system, antitoxin Phd/YefM

(1-50)


Sequences

Toxin        


Download         Length: 123 a.a.        Molecular weight: 13552.92 Da        Isoelectric Point: 8.6410

>T281878 WP_002920800.1 NZ_CP125083:4359831-4360199 [Klebsiella pneumoniae subsp. pneumoniae]
MTLQIISAEEIIQFHDRLLRVTPGVAGMPDPGRAEAIMYRVLNKIEYEGVTDVWRLAAMHLLAISRGHIFNDGNKRTALF
ITLLFLKRNGIILPANPDFVGMTVEAAAGQLTLEQIVARLRG

Download         Length: 369 bp

Antitoxin


Download         Length: 74 a.a.        Molecular weight: 8151.15 Da        Isoelectric Point: 4.7769

>AT281878 WP_004174006.1 NZ_CP125083:4359613-4359834 [Klebsiella pneumoniae subsp. pneumoniae]
MRTVNYSEARQNLADVLESAVTGVPVTITRRGHKSAVIISAEEFERYQAARMDDEFAAIMAVHGDEIRELADK

Download         Length: 222 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A0H3GUD1

Antitoxin

Source ID Structure
AlphaFold DB A0A5E5YJY7

References