Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/Tad-HTH_37 |
Location | 2594041..2594638 | Replicon | chromosome |
Accession | NZ_CP125083 | ||
Organism | Klebsiella pneumoniae subsp. pneumoniae strain HVKP1 |
Toxin (Protein)
Gene name | higB | Uniprot ID | R4YIC5 |
Locus tag | QFB57_RS13505 | Protein ID | WP_004142563.1 |
Coordinates | 2594321..2594638 (-) | Length | 106 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | R4YH91 |
Locus tag | QFB57_RS13500 | Protein ID | WP_004142561.1 |
Coordinates | 2594041..2594328 (-) | Length | 96 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QFB57_RS13470 (2590120) | 2590120..2590368 | + | 249 | WP_032445695.1 | DUF1158 domain-containing protein | - |
QFB57_RS13475 (2590386) | 2590386..2590727 | - | 342 | WP_002893035.1 | RamA family antibiotic efflux transcriptional regulator | - |
QFB57_RS13480 (2590758) | 2590758..2591873 | - | 1116 | WP_012737592.1 | MBL fold metallo-hydrolase | - |
QFB57_RS13485 (2592053) | 2592053..2592634 | + | 582 | WP_004176968.1 | TetR/AcrR family transcriptional regulator | - |
QFB57_RS13490 (2592634) | 2592634..2593003 | + | 370 | Protein_2444 | MmcQ/YjbR family DNA-binding protein | - |
QFB57_RS13495 (2593123) | 2593123..2593776 | + | 654 | WP_004178896.1 | oxygen-insensitive NAD(P)H nitroreductase | - |
QFB57_RS13500 (2594041) | 2594041..2594328 | - | 288 | WP_004142561.1 | helix-turn-helix transcriptional regulator | Antitoxin |
QFB57_RS13505 (2594321) | 2594321..2594638 | - | 318 | WP_004142563.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
QFB57_RS13510 (2594823) | 2594823..2595866 | - | 1044 | WP_016946853.1 | DUF2157 domain-containing protein | - |
QFB57_RS13515 (2596532) | 2596532..2597398 | - | 867 | Protein_2449 | helix-turn-helix transcriptional regulator | - |
QFB57_RS13520 (2597507) | 2597507..2598934 | + | 1428 | WP_004176980.1 | MFS transporter | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 106 a.a. Molecular weight: 12110.39 Da Isoelectric Point: 11.2767
>T281871 WP_004142563.1 NZ_CP125083:c2594638-2594321 [Klebsiella pneumoniae subsp. pneumoniae]
MFRLVVHVDVKKELQALPPIVQAKMIRQLDKLRQNPTALREPDSKPLGQGLFEIRALGSVQGRGIYVFQQGKTLFLLRVF
VKKTQKTPSSEIRLALKRLEEMRNE
MFRLVVHVDVKKELQALPPIVQAKMIRQLDKLRQNPTALREPDSKPLGQGLFEIRALGSVQGRGIYVFQQGKTLFLLRVF
VKKTQKTPSSEIRLALKRLEEMRNE
Download Length: 318 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0M5MXH8 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0S3DIQ1 |