Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/HigB-HigA |
| Location | 130521..131157 | Replicon | chromosome |
| Accession | NZ_CP124968 | ||
| Organism | Agrobacterium tumefaciens strain O54/95 | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | A0A846LJX3 |
| Locus tag | G6L90_RS15130 | Protein ID | WP_060727225.1 |
| Coordinates | 130876..131157 (-) | Length | 94 a.a. |
Antitoxin (Protein)
| Gene name | graA | Uniprot ID | A0A846LMK5 |
| Locus tag | G6L90_RS15125 | Protein ID | WP_060727224.1 |
| Coordinates | 130521..130820 (-) | Length | 100 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| G6L90_RS15100 (G6L90_15100) | 125704..126432 | - | 729 | WP_080864439.1 | ABC transporter ATP-binding protein | - |
| G6L90_RS15105 (G6L90_15105) | 126429..127337 | - | 909 | WP_020009811.1 | branched-chain amino acid ABC transporter permease | - |
| G6L90_RS15110 (G6L90_15110) | 127334..128206 | - | 873 | WP_113076637.1 | branched-chain amino acid ABC transporter permease | - |
| G6L90_RS15115 (G6L90_15115) | 128277..129491 | - | 1215 | WP_020009809.1 | amino acid ABC transporter substrate-binding protein | - |
| G6L90_RS15120 (G6L90_15120) | 129627..130499 | + | 873 | WP_129566064.1 | AraC family transcriptional regulator | - |
| G6L90_RS15125 (G6L90_15125) | 130521..130820 | - | 300 | WP_060727224.1 | HigA family addiction module antitoxin | Antitoxin |
| G6L90_RS15130 (G6L90_15130) | 130876..131157 | - | 282 | WP_060727225.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| G6L90_RS15135 (G6L90_15135) | 131233..132042 | - | 810 | WP_060727226.1 | ABC transporter ATP-binding protein | - |
| G6L90_RS15140 (G6L90_15140) | 132039..133073 | - | 1035 | WP_060727227.1 | iron chelate uptake ABC transporter family permease subunit | - |
| G6L90_RS15145 (G6L90_15145) | 133076..134119 | - | 1044 | WP_174071003.1 | iron ABC transporter permease | - |
| G6L90_RS15150 (G6L90_15150) | 134116..135126 | - | 1011 | WP_174071001.1 | iron-siderophore ABC transporter substrate-binding protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 94 a.a. Molecular weight: 10562.03 Da Isoelectric Point: 8.0066
>T281862 WP_060727225.1 NZ_CP124968:c131157-130876 [Agrobacterium tumefaciens]
MIRSFKNKLAASIDDGSVKKVFPADLVRRAQQLLTILDAATTVEDLRSPPGNRLEKLSGDREGQYSIRINKQWRICFVWT
EAGPESVEITDYH
MIRSFKNKLAASIDDGSVKKVFPADLVRRAQQLLTILDAATTVEDLRSPPGNRLEKLSGDREGQYSIRINKQWRICFVWT
EAGPESVEITDYH
Download Length: 282 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A846LJX3 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A846LMK5 |