Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | txpA-ratA/- |
| Location | 2700550..2701008 | Replicon | chromosome |
| Accession | NZ_CP124921 | ||
| Organism | Enterococcus faecalis strain EfsC12 | ||
Toxin (Protein)
| Gene name | txpA | Uniprot ID | S4BYM2 |
| Locus tag | QLQ56_RS12950 | Protein ID | WP_002392696.1 |
| Coordinates | 2700865..2701008 (-) | Length | 48 a.a. |
Antitoxin (RNA)
| Gene name | ratA | ||
| Locus tag | - | ||
| Coordinates | 2700550..2700690 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QLQ56_RS12935 (2696111) | 2696111..2696824 | - | 714 | WP_002367455.1 | trehalose operon repressor | - |
| QLQ56_RS12940 (2697086) | 2697086..2699830 | + | 2745 | WP_047648974.1 | glycosyl hydrolase family 65 protein | - |
| QLQ56_RS12945 (2699845) | 2699845..2700495 | + | 651 | WP_002354875.1 | beta-phosphoglucomutase | - |
| - (2700550) | 2700550..2700690 | + | 141 | NuclAT_10 | - | Antitoxin |
| - (2700746) | 2700746..2700891 | + | 146 | NuclAT_12 | - | - |
| - (2700746) | 2700746..2700932 | + | 187 | NuclAT_9 | - | - |
| QLQ56_RS12950 (2700865) | 2700865..2701008 | - | 144 | WP_002392696.1 | type I toxin-antitoxin system toxin PepG1 | Toxin |
| - (2701121) | 2701121..2701266 | + | 146 | NuclAT_13 | - | - |
| - (2701109) | 2701109..2701307 | + | 199 | NuclAT_8 | - | - |
| QLQ56_RS12955 (2701240) | 2701240..2701383 | - | 144 | WP_002392696.1 | type I toxin-antitoxin system toxin PepG1 | - |
| QLQ56_RS12960 (2701615) | 2701615..2702586 | - | 972 | WP_002381060.1 | ribose-phosphate diphosphokinase | - |
| QLQ56_RS12965 (2702761) | 2702761..2703198 | - | 438 | WP_002354871.1 | peptide-methionine (R)-S-oxide reductase MsrB | - |
| QLQ56_RS12970 (2703331) | 2703331..2703885 | - | 555 | WP_002354869.1 | Maf family protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 48 a.a. Molecular weight: 5297.43 Da Isoelectric Point: 10.6867
>T281811 WP_002392696.1 NZ_CP124921:c2701008-2700865 [Enterococcus faecalis]
MSVLPKFTERRGLLSAYETIQTILGFGMFTIALIALIVKLLKNDNKK
MSVLPKFTERRGLLSAYETIQTILGFGMFTIALIALIVKLLKNDNKK
Download Length: 144 bp
Antitoxin
Download Length: 141 bp
>AT281811 NZ_CP124921:2700550-2700690 [Enterococcus faecalis]
TGCTAGAATGTAGATAAAAAGAGAGAGATGCGTCAACACACCTCTCTAGTGTAGAGCCGTTTGAGACGGTGACCTTTTGG
ATTAATTAAAAATAACCGTGCTTGGTCAAAGTAAACGGTTATTTTTTATTGTCATTTTTAA
TGCTAGAATGTAGATAAAAAGAGAGAGATGCGTCAACACACCTCTCTAGTGTAGAGCCGTTTGAGACGGTGACCTTTTGG
ATTAATTAAAAATAACCGTGCTTGGTCAAAGTAAACGGTTATTTTTTATTGTCATTTTTAA
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|