Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | fst-RNAII/- |
Location | 317631..317826 | Replicon | chromosome |
Accession | NZ_CP124921 | ||
Organism | Enterococcus faecalis strain EfsC12 |
Toxin (Protein)
Gene name | fst | Uniprot ID | - |
Locus tag | QLQ56_RS01620 | Protein ID | WP_015543884.1 |
Coordinates | 317731..317826 (-) | Length | 32 a.a. |
Antitoxin (RNA)
Gene name | RNAII | ||
Locus tag | - | ||
Coordinates | 317631..317696 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QLQ56_RS01605 (313257) | 313257..315005 | + | 1749 | WP_002397549.1 | PTS transporter subunit EIIC | - |
QLQ56_RS01610 (314996) | 314996..317029 | + | 2034 | WP_002397548.1 | BglG family transcription antiterminator | - |
QLQ56_RS01615 (317040) | 317040..317474 | + | 435 | WP_002358391.1 | PTS sugar transporter subunit IIA | - |
- (317631) | 317631..317696 | + | 66 | NuclAT_15 | - | Antitoxin |
QLQ56_RS01620 (317731) | 317731..317826 | - | 96 | WP_015543884.1 | type I toxin-antitoxin system Fst family toxin | Toxin |
QLQ56_RS01625 (318072) | 318072..319844 | + | 1773 | WP_002405272.1 | PTS mannitol-specific transporter subunit IIBC | - |
QLQ56_RS01630 (319859) | 319859..320296 | + | 438 | WP_002355279.1 | PTS sugar transporter subunit IIA | - |
QLQ56_RS01635 (320311) | 320311..321465 | + | 1155 | WP_002386082.1 | mannitol-1-phosphate 5-dehydrogenase | - |
QLQ56_RS01640 (321534) | 321534..322649 | - | 1116 | WP_002397546.1 | FAD-dependent oxidoreductase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 32 a.a. Molecular weight: 3659.47 Da Isoelectric Point: 4.6275
>T281799 WP_015543884.1 NZ_CP124921:c317826-317731 [Enterococcus faecalis]
MYEIVTKILVPIFVGIVLKLVTIWLEKQNEE
MYEIVTKILVPIFVGIVLKLVTIWLEKQNEE
Download Length: 96 bp
Antitoxin
Download Length: 66 bp
>AT281799 NZ_CP124921:317631-317696 [Enterococcus faecalis]
CTTGTGACAAAGTCGTGCATGGATGCACTAAAAAGACACCCTATCAGTAGTAGGGTGTCTTTTTTT
CTTGTGACAAAGTCGTGCATGGATGCACTAAAAAGACACCCTATCAGTAGTAGGGTGTCTTTTTTT
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|