Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type I Classification (family/domain) fst-RNAII/Fst(toxin)
Location 42155..42396 Replicon plasmid p2_EfsC9_rep9b
Accession NZ_CP124920
Organism Enterococcus faecalis strain EfsC9

Toxin (Protein)


Gene name fst Uniprot ID -
Locus tag QLQ61_RS15055 Protein ID WP_002360667.1
Coordinates 42155..42265 (+) Length 37 a.a.

Antitoxin (RNA)


Gene name RNAII
Locus tag -
Coordinates 42305..42396 (-)

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
QLQ61_RS15010 (37173) 37173..37976 + 804 WP_002404172.1 AAA family ATPase -
QLQ61_RS15015 (38076) 38076..38696 + 621 WP_002367819.1 recombinase family protein -
QLQ61_RS15020 (38686) 38686..39000 + 315 WP_048953689.1 hypothetical protein -
QLQ61_RS15025 (38994) 38994..39218 + 225 WP_002383635.1 ultraviolet resistance protein UvrA repressor UvrC -
QLQ61_RS15030 (39279) 39279..39488 + 210 WP_002383636.1 hypothetical protein -
QLQ61_RS15035 (39650) 39650..39802 + 153 WP_225850000.1 DUF6440 family protein -
QLQ61_RS15040 (40229) 40229..41557 + 1329 WP_002400994.1 ultraviolet resistance protein UvrA -
QLQ61_RS15045 (41554) 41554..41904 + 351 WP_002399364.1 hypothetical protein -
QLQ61_RS15050 (41861) 41861..42073 + 213 WP_002360669.1 hypothetical protein -
QLQ61_RS15055 (42155) 42155..42265 + 111 WP_002360667.1 type I toxin-antitoxin system Fst family toxin Toxin
- (42305) 42305..42396 - 92 NuclAT_0 - Antitoxin
- (42305) 42305..42396 - 92 NuclAT_0 - Antitoxin
- (42305) 42305..42396 - 92 NuclAT_0 - Antitoxin
- (42305) 42305..42396 - 92 NuclAT_0 - Antitoxin
QLQ61_RS15060 (42505) 42505..42801 + 297 WP_002360665.1 replication control protein PrgN -
QLQ61_RS15065 (43055) 43055..43837 + 783 WP_002360664.1 ParA family protein -
QLQ61_RS15070 (43830) 43830..44186 + 357 WP_002360663.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Non-Mobilizable plasmid - - 1..44445 44445


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin


No domain identified.



Sequences

Toxin        


Download         Length: 37 a.a.        Molecular weight: 4117.92 Da        Isoelectric Point: 4.1672

>T281797 WP_002360667.1 NZ_CP124920:42155-42265 [Enterococcus faecalis]
VLFVKDLMSLVIAPIFVGLVLEMISRVLDEEDDNRK

Download         Length: 111 bp

Antitoxin


Download         Length: 92 bp

>AT281797 NZ_CP124920:c42396-42305 [Enterococcus faecalis]
TAAAAATATGTTATACTAAAGGTGCGAAACGACATTAAATCGTACAAATAACACAAAAAGCAATCCTACGGCGAATAGGA
TTGCTTTTTTTT

Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Download structure file

References