Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | fst-RNAII/Fst(toxin) |
| Location | 42155..42396 | Replicon | plasmid p2_EfsC9_rep9b |
| Accession | NZ_CP124920 | ||
| Organism | Enterococcus faecalis strain EfsC9 | ||
Toxin (Protein)
| Gene name | fst | Uniprot ID | - |
| Locus tag | QLQ61_RS15055 | Protein ID | WP_002360667.1 |
| Coordinates | 42155..42265 (+) | Length | 37 a.a. |
Antitoxin (RNA)
| Gene name | RNAII | ||
| Locus tag | - | ||
| Coordinates | 42305..42396 (-) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QLQ61_RS15010 (37173) | 37173..37976 | + | 804 | WP_002404172.1 | AAA family ATPase | - |
| QLQ61_RS15015 (38076) | 38076..38696 | + | 621 | WP_002367819.1 | recombinase family protein | - |
| QLQ61_RS15020 (38686) | 38686..39000 | + | 315 | WP_048953689.1 | hypothetical protein | - |
| QLQ61_RS15025 (38994) | 38994..39218 | + | 225 | WP_002383635.1 | ultraviolet resistance protein UvrA repressor UvrC | - |
| QLQ61_RS15030 (39279) | 39279..39488 | + | 210 | WP_002383636.1 | hypothetical protein | - |
| QLQ61_RS15035 (39650) | 39650..39802 | + | 153 | WP_225850000.1 | DUF6440 family protein | - |
| QLQ61_RS15040 (40229) | 40229..41557 | + | 1329 | WP_002400994.1 | ultraviolet resistance protein UvrA | - |
| QLQ61_RS15045 (41554) | 41554..41904 | + | 351 | WP_002399364.1 | hypothetical protein | - |
| QLQ61_RS15050 (41861) | 41861..42073 | + | 213 | WP_002360669.1 | hypothetical protein | - |
| QLQ61_RS15055 (42155) | 42155..42265 | + | 111 | WP_002360667.1 | type I toxin-antitoxin system Fst family toxin | Toxin |
| - (42305) | 42305..42396 | - | 92 | NuclAT_0 | - | Antitoxin |
| - (42305) | 42305..42396 | - | 92 | NuclAT_0 | - | Antitoxin |
| - (42305) | 42305..42396 | - | 92 | NuclAT_0 | - | Antitoxin |
| - (42305) | 42305..42396 | - | 92 | NuclAT_0 | - | Antitoxin |
| QLQ61_RS15060 (42505) | 42505..42801 | + | 297 | WP_002360665.1 | replication control protein PrgN | - |
| QLQ61_RS15065 (43055) | 43055..43837 | + | 783 | WP_002360664.1 | ParA family protein | - |
| QLQ61_RS15070 (43830) | 43830..44186 | + | 357 | WP_002360663.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Non-Mobilizable plasmid | - | - | 1..44445 | 44445 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 37 a.a. Molecular weight: 4117.92 Da Isoelectric Point: 4.1672
>T281797 WP_002360667.1 NZ_CP124920:42155-42265 [Enterococcus faecalis]
VLFVKDLMSLVIAPIFVGLVLEMISRVLDEEDDNRK
VLFVKDLMSLVIAPIFVGLVLEMISRVLDEEDDNRK
Download Length: 111 bp
Antitoxin
Download Length: 92 bp
>AT281797 NZ_CP124920:c42396-42305 [Enterococcus faecalis]
TAAAAATATGTTATACTAAAGGTGCGAAACGACATTAAATCGTACAAATAACACAAAAAGCAATCCTACGGCGAATAGGA
TTGCTTTTTTTT
TAAAAATATGTTATACTAAAGGTGCGAAACGACATTAAATCGTACAAATAACACAAAAAGCAATCCTACGGCGAATAGGA
TTGCTTTTTTTT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|