Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | fst-RNAII/Fst(toxin) |
Location | 92012..92253 | Replicon | plasmid p1_EfsC9_rep9a |
Accession | NZ_CP124919 | ||
Organism | Enterococcus faecalis strain EfsC9 |
Toxin (Protein)
Gene name | fst | Uniprot ID | - |
Locus tag | QLQ61_RS14800 | Protein ID | WP_002360667.1 |
Coordinates | 92012..92122 (+) | Length | 37 a.a. |
Antitoxin (RNA)
Gene name | RNAII | ||
Locus tag | - | ||
Coordinates | 92162..92253 (-) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QLQ61_RS14775 (87150) | 87150..90122 | - | 2973 | WP_000653331.1 | Tn3 family transposase | - |
QLQ61_RS14780 (90253) | 90253..90858 | + | 606 | WP_000238804.1 | recombinase family protein | - |
QLQ61_RS14785 (90920) | 90920..91414 | + | 495 | Protein_99 | ultraviolet resistance protein UvrA | - |
QLQ61_RS14790 (91411) | 91411..91761 | + | 351 | WP_002399364.1 | hypothetical protein | - |
QLQ61_RS14795 (91718) | 91718..91930 | + | 213 | WP_002360669.1 | hypothetical protein | - |
QLQ61_RS14800 (92012) | 92012..92122 | + | 111 | WP_002360667.1 | type I toxin-antitoxin system Fst family toxin | Toxin |
- (92162) | 92162..92253 | - | 92 | NuclAT_0 | - | Antitoxin |
- (92162) | 92162..92253 | - | 92 | NuclAT_0 | - | Antitoxin |
- (92162) | 92162..92253 | - | 92 | NuclAT_0 | - | Antitoxin |
- (92162) | 92162..92253 | - | 92 | NuclAT_0 | - | Antitoxin |
QLQ61_RS14805 (92362) | 92362..92652 | + | 291 | WP_001137528.1 | hypothetical protein | - |
QLQ61_RS14810 (92756) | 92756..93127 | - | 372 | WP_000049959.1 | replication-associated protein RepC | - |
QLQ61_RS14815 (93120) | 93120..93965 | - | 846 | WP_000239313.1 | AAA family ATPase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Mobilizable plasmid | - | prgB/asc10 | 1..94436 | 94436 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 37 a.a. Molecular weight: 4117.92 Da Isoelectric Point: 4.1672
>T281793 WP_002360667.1 NZ_CP124919:92012-92122 [Enterococcus faecalis]
VLFVKDLMSLVIAPIFVGLVLEMISRVLDEEDDNRK
VLFVKDLMSLVIAPIFVGLVLEMISRVLDEEDDNRK
Download Length: 111 bp
Antitoxin
Download Length: 92 bp
>AT281793 NZ_CP124919:c92253-92162 [Enterococcus faecalis]
TAAAAATATGTTATACTAAAGGTGCGAAACGACATTAAATCGTACAAATAACACAAAAAGCAATCCTACGGCGAATAGGA
TTGCTTTTTTTT
TAAAAATATGTTATACTAAAGGTGCGAAACGACATTAAATCGTACAAATAACACAAAAAGCAATCCTACGGCGAATAGGA
TTGCTTTTTTTT
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|