Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | txpA-ratA/- |
| Location | 2807459..2807795 | Replicon | chromosome |
| Accession | NZ_CP124918 | ||
| Organism | Enterococcus faecalis strain EfsC9 | ||
Toxin (Protein)
| Gene name | txpA | Uniprot ID | E2Z0W4 |
| Locus tag | QLQ61_RS13860 | Protein ID | WP_002381035.1 |
| Coordinates | 2807459..2807602 (+) | Length | 48 a.a. |
Antitoxin (RNA)
| Gene name | ratA | ||
| Locus tag | - | ||
| Coordinates | 2807746..2807795 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QLQ61_RS13840 (2803560) | 2803560..2804189 | - | 630 | WP_002354763.1 | lytic polysaccharide monooxygenase | - |
| QLQ61_RS13845 (2804882) | 2804882..2806498 | + | 1617 | WP_002381036.1 | phosphatase PAP2/LCP family protein | - |
| QLQ61_RS13850 (2806828) | 2806828..2806971 | + | 144 | WP_002392818.1 | type I toxin-antitoxin system toxin PepG1 | - |
| - (2806904) | 2806904..2807088 | - | 185 | NuclAT_6 | - | - |
| - (2806945) | 2806945..2807088 | - | 144 | NuclAT_10 | - | - |
| QLQ61_RS13855 (2807090) | 2807090..2807230 | + | 141 | WP_073340360.1 | putative holin-like toxin | - |
| - (2807163) | 2807163..2807361 | - | 199 | NuclAT_4 | - | - |
| QLQ61_RS13860 (2807459) | 2807459..2807602 | + | 144 | WP_002381035.1 | putative holin-like toxin | Toxin |
| - (2807746) | 2807746..2807795 | + | 50 | NuclAT_11 | - | Antitoxin |
| - (2807534) | 2807534..2807796 | - | 263 | NuclAT_8 | - | - |
| QLQ61_RS13865 (2807797) | 2807797..2812488 | - | 4692 | WP_282874514.1 | WxL domain-containing protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 48 a.a. Molecular weight: 5202.20 Da Isoelectric Point: 10.0041
>T281789 WP_002381035.1 NZ_CP124918:2807459-2807602 [Enterococcus faecalis]
MNVSTKIYERRGLLSIAEALALMISFGSFIATLIFGILEAVKENNKK
MNVSTKIYERRGLLSIAEALALMISFGSFIATLIFGILEAVKENNKK
Download Length: 144 bp
Antitoxin
Download Length: 50 bp
>AT281789 NZ_CP124918:2807746-2807795 [Enterococcus faecalis]
AATAAAAATGCCCGAGCCTTAGAAAAATAAGAGGCTCGGGCATTTTTATT
AATAAAAATGCCCGAGCCTTAGAAAAATAAGAGGCTCGGGCATTTTTATT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|