Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | txpA-ratA/- |
| Location | 2722160..2722623 | Replicon | chromosome |
| Accession | NZ_CP124918 | ||
| Organism | Enterococcus faecalis strain EfsC9 | ||
Toxin (Protein)
| Gene name | txpA | Uniprot ID | S4BYM2 |
| Locus tag | QLQ61_RS13470 | Protein ID | WP_002392696.1 |
| Coordinates | 2722160..2722303 (-) | Length | 48 a.a. |
Antitoxin (RNA)
| Gene name | ratA | ||
| Locus tag | - | ||
| Coordinates | 2722479..2722623 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QLQ61_RS13455 (2717406) | 2717406..2718119 | - | 714 | WP_002381063.1 | trehalose operon repressor | - |
| QLQ61_RS13460 (2718381) | 2718381..2721125 | + | 2745 | WP_002398920.1 | glycosyl hydrolase family 65 protein | - |
| QLQ61_RS13465 (2721140) | 2721140..2721790 | + | 651 | WP_002354875.1 | beta-phosphoglucomutase | - |
| - (2722040) | 2722040..2722227 | + | 188 | NuclAT_5 | - | - |
| QLQ61_RS13470 (2722160) | 2722160..2722303 | - | 144 | WP_002392696.1 | type I toxin-antitoxin system toxin PepG1 | Toxin |
| - (2722479) | 2722479..2722623 | + | 145 | NuclAT_9 | - | Antitoxin |
| QLQ61_RS13475 (2723377) | 2723377..2723652 | + | 276 | WP_224805966.1 | CPBP family intramembrane metalloprotease | - |
| QLQ61_RS13480 (2723705) | 2723705..2724676 | - | 972 | WP_002381060.1 | ribose-phosphate diphosphokinase | - |
| QLQ61_RS13485 (2724851) | 2724851..2725288 | - | 438 | WP_002354871.1 | peptide-methionine (R)-S-oxide reductase MsrB | - |
| QLQ61_RS13490 (2725421) | 2725421..2725975 | - | 555 | WP_002354869.1 | Maf family protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 48 a.a. Molecular weight: 5297.43 Da Isoelectric Point: 10.6867
>T281774 WP_002392696.1 NZ_CP124918:c2722303-2722160 [Enterococcus faecalis]
MSVLPKFTERRGLLSAYETIQTILGFGMFTIALIALIVKLLKNDNKK
MSVLPKFTERRGLLSAYETIQTILGFGMFTIALIALIVKLLKNDNKK
Download Length: 144 bp
Antitoxin
Download Length: 145 bp
>AT281774 NZ_CP124918:2722479-2722623 [Enterococcus faecalis]
TTGTGCTATAATGAAAACGAAAAGAGAGATATGCTTCAACATACCTCTCTGATGCAGAGCCGTTTAAGACGGTGACCGAT
TTTGTTACAAAAAATAACCGTACTCAGTCAAAGTAGACGGTTATTTTTTATTGTCATTTTTAACA
TTGTGCTATAATGAAAACGAAAAGAGAGATATGCTTCAACATACCTCTCTGATGCAGAGCCGTTTAAGACGGTGACCGAT
TTTGTTACAAAAAATAACCGTACTCAGTCAAAGTAGACGGTTATTTTTTATTGTCATTTTTAACA
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|