Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | fst-RNAII/Fst(toxin) |
Location | 59411..59652 | Replicon | plasmid p1_EfsC17_rep9b |
Accession | NZ_CP124917 | ||
Organism | Enterococcus faecalis strain EfsC17 |
Toxin (Protein)
Gene name | fst | Uniprot ID | - |
Locus tag | QLQ62_RS14620 | Protein ID | WP_002360667.1 |
Coordinates | 59411..59521 (+) | Length | 37 a.a. |
Antitoxin (RNA)
Gene name | RNAII | ||
Locus tag | - | ||
Coordinates | 59561..59652 (-) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QLQ62_RS14575 (54637) | 54637..55224 | + | 588 | WP_010830316.1 | hypothetical protein | - |
QLQ62_RS14580 (55355) | 55355..55951 | + | 597 | WP_153829629.1 | recombinase family protein | - |
QLQ62_RS14585 (55941) | 55941..56255 | + | 315 | WP_174091296.1 | hypothetical protein | - |
QLQ62_RS14590 (56249) | 56249..56473 | + | 225 | WP_002414746.1 | ultraviolet resistance protein UvrA repressor UvrC | - |
QLQ62_RS14595 (56534) | 56534..56743 | + | 210 | WP_010822516.1 | hypothetical protein | - |
QLQ62_RS14600 (56755) | 56755..57057 | + | 303 | WP_002393766.1 | DUF6440 family protein | - |
QLQ62_RS14605 (57485) | 57485..58813 | + | 1329 | WP_002370254.1 | ultraviolet resistance protein UvrA | - |
QLQ62_RS14610 (58810) | 58810..59160 | + | 351 | WP_002399364.1 | hypothetical protein | - |
QLQ62_RS14615 (59117) | 59117..59329 | + | 213 | WP_002360669.1 | hypothetical protein | - |
QLQ62_RS14620 (59411) | 59411..59521 | + | 111 | WP_002360667.1 | type I toxin-antitoxin system Fst family toxin | Toxin |
- (59561) | 59561..59652 | - | 92 | NuclAT_0 | - | Antitoxin |
- (59561) | 59561..59652 | - | 92 | NuclAT_0 | - | Antitoxin |
- (59561) | 59561..59652 | - | 92 | NuclAT_0 | - | Antitoxin |
- (59561) | 59561..59652 | - | 92 | NuclAT_0 | - | Antitoxin |
QLQ62_RS14625 (59761) | 59761..60057 | + | 297 | WP_002360665.1 | replication control protein PrgN | - |
QLQ62_RS14630 (60311) | 60311..61093 | + | 783 | WP_174094941.1 | ParA family protein | - |
QLQ62_RS14635 (61086) | 61086..61442 | + | 357 | WP_282855876.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Non-Mobilizable plasmid | - | prgB/asc10 | 1..61701 | 61701 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 37 a.a. Molecular weight: 4117.92 Da Isoelectric Point: 4.1672
>T281766 WP_002360667.1 NZ_CP124917:59411-59521 [Enterococcus faecalis]
VLFVKDLMSLVIAPIFVGLVLEMISRVLDEEDDNRK
VLFVKDLMSLVIAPIFVGLVLEMISRVLDEEDDNRK
Download Length: 111 bp
Antitoxin
Download Length: 92 bp
>AT281766 NZ_CP124917:c59652-59561 [Enterococcus faecalis]
TAAAAATATGTTATACTAAAGGTGCGAAACGACATTAAATCGTACAAATAACACAAAAAGCAATCCTACGGCGAATAGGA
TTGCTTTTTTTT
TAAAAATATGTTATACTAAAGGTGCGAAACGACATTAAATCGTACAAATAACACAAAAAGCAATCCTACGGCGAATAGGA
TTGCTTTTTTTT
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|