Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | txpA-ratA/- |
| Location | 2802922..2803258 | Replicon | chromosome |
| Accession | NZ_CP124916 | ||
| Organism | Enterococcus faecalis strain EfsC17 | ||
Toxin (Protein)
| Gene name | txpA | Uniprot ID | E2Z0W4 |
| Locus tag | QLQ62_RS13870 | Protein ID | WP_002381035.1 |
| Coordinates | 2802922..2803065 (+) | Length | 48 a.a. |
Antitoxin (RNA)
| Gene name | ratA | ||
| Locus tag | - | ||
| Coordinates | 2803209..2803258 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QLQ62_RS13850 | 2798102..2798317 | - | 216 | WP_002354768.1 | zinc ribbon domain-containing protein | - |
| QLQ62_RS13855 | 2798456..2799448 | + | 993 | WP_002389493.1 | biotin--[acetyl-CoA-carboxylase] ligase | - |
| QLQ62_RS13860 | 2799712..2800350 | - | 639 | WP_002378863.1 | lytic polysaccharide monooxygenase | - |
| QLQ62_RS13865 | 2801036..2802652 | + | 1617 | WP_002389442.1 | phosphatase PAP2/LCP family protein | - |
| QLQ62_RS13870 | 2802922..2803065 | + | 144 | WP_002381035.1 | putative holin-like toxin | Toxin |
| - | 2803209..2803258 | + | 50 | - | - | Antitoxin |
| QLQ62_RS13875 | 2803260..2807087 | - | 3828 | WP_010816211.1 | WxL domain-containing protein | - |
| QLQ62_RS13880 | 2807074..2807436 | - | 363 | WP_002378868.1 | LPXTG cell wall anchor domain-containing protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 48 a.a. Molecular weight: 5202.20 Da Isoelectric Point: 10.0041
>T281762 WP_002381035.1 NZ_CP124916:2802922-2803065 [Enterococcus faecalis]
MNVSTKIYERRGLLSIAEALALMISFGSFIATLIFGILEAVKENNKK
MNVSTKIYERRGLLSIAEALALMISFGSFIATLIFGILEAVKENNKK
Download Length: 144 bp
Antitoxin
Download Length: 50 bp
>AT281762 NZ_CP124916:2803209-2803258 [Enterococcus faecalis]
AATAAAAATGCCCGAGCCTTAGAAAAATAAGAGGCTCGGGCATTTTTATT
AATAAAAATGCCCGAGCCTTAGAAAAATAAGAGGCTCGGGCATTTTTATT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|