Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | txpA-ratA/- |
Location | 2520866..2521090 | Replicon | chromosome |
Accession | NZ_CP124914 | ||
Organism | Enterococcus faecalis strain EfsC8 |
Toxin (Protein)
Gene name | txpA | Uniprot ID | - |
Locus tag | QLQ37_RS12000 | Protein ID | WP_023894767.1 |
Coordinates | 2520986..2521090 (-) | Length | 35 a.a. |
Antitoxin (RNA)
Gene name | ratA | ||
Locus tag | - | ||
Coordinates | 2520866..2521053 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QLQ37_RS11985 (2516299) | 2516299..2517012 | - | 714 | WP_002354877.1 | trehalose operon repressor | - |
QLQ37_RS11990 (2517273) | 2517273..2520017 | + | 2745 | WP_129226010.1 | glycosyl hydrolase family 65 protein | - |
QLQ37_RS11995 (2520032) | 2520032..2520682 | + | 651 | WP_016614233.1 | beta-phosphoglucomutase | - |
- (2520866) | 2520866..2521053 | + | 188 | NuclAT_4 | - | Antitoxin |
QLQ37_RS12000 (2520986) | 2520986..2521090 | - | 105 | WP_023894767.1 | putative holin-like toxin | Toxin |
- (2521242) | 2521242..2521384 | + | 143 | NuclAT_10 | - | - |
QLQ37_RS12005 (2521475) | 2521475..2521597 | - | 123 | WP_002419628.1 | hypothetical protein | - |
QLQ37_RS12010 (2522390) | 2522390..2523361 | - | 972 | WP_002381060.1 | ribose-phosphate diphosphokinase | - |
QLQ37_RS12015 (2523536) | 2523536..2523973 | - | 438 | WP_010715474.1 | peptide-methionine (R)-S-oxide reductase MsrB | - |
QLQ37_RS12020 (2524106) | 2524106..2524660 | - | 555 | WP_033601100.1 | nucleoside triphosphate pyrophosphatase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 35 a.a. Molecular weight: 3799.63 Da Isoelectric Point: 10.0079
>T281741 WP_023894767.1 NZ_CP124914:c2521090-2520986 [Enterococcus faecalis]
MSAYETIQTILGFGMFTIALIALIVKLLKNDNKK
MSAYETIQTILGFGMFTIALIALIVKLLKNDNKK
Download Length: 105 bp
Antitoxin
Download Length: 188 bp
>AT281741 NZ_CP124914:2520866-2521053 [Enterococcus faecalis]
TGTGCTATAATGAAAATGAAAAGAGAGATATGCTTCAACATACCTCTCTGATGTAGAGCCGTTTAAGACGGTGACCATGT
TAATTATTTAAAAATAACCGTGCTTGGTCAAAGTTGACGGTTATTTTTTATTGTCATTTTTAAGCAATTTCACAATCAGC
GCAATCAAAGCAATGGTAAACATACCAA
TGTGCTATAATGAAAATGAAAAGAGAGATATGCTTCAACATACCTCTCTGATGTAGAGCCGTTTAAGACGGTGACCATGT
TAATTATTTAAAAATAACCGTGCTTGGTCAAAGTTGACGGTTATTTTTTATTGTCATTTTTAAGCAATTTCACAATCAGC
GCAATCAAAGCAATGGTAAACATACCAA
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|