Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | txpA-ratA/- |
| Location | 2884269..2884605 | Replicon | chromosome |
| Accession | NZ_CP124911 | ||
| Organism | Enterococcus faecalis strain EfsC61 | ||
Toxin (Protein)
| Gene name | txpA | Uniprot ID | A0A125WAU0 |
| Locus tag | QLQ53_RS14215 | Protein ID | WP_002391551.1 |
| Coordinates | 2884269..2884412 (+) | Length | 48 a.a. |
Antitoxin (RNA)
| Gene name | ratA | ||
| Locus tag | - | ||
| Coordinates | 2884556..2884605 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QLQ53_RS14200 | 2879985..2880617 | - | 633 | WP_002358972.1 | RloB family protein | - |
| QLQ53_RS14205 | 2880626..2881921 | - | 1296 | WP_010785619.1 | ATP-binding protein | - |
| QLQ53_RS14210 | 2882383..2883999 | + | 1617 | WP_002365430.1 | phosphatase PAP2/LCP family protein | - |
| QLQ53_RS14215 | 2884269..2884412 | + | 144 | WP_002391551.1 | putative holin-like toxin | Toxin |
| - | 2884556..2884605 | + | 50 | - | - | Antitoxin |
| QLQ53_RS14220 | 2884607..2887624 | - | 3018 | WP_010830429.1 | WxL domain-containing protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 48 a.a. Molecular weight: 5175.17 Da Isoelectric Point: 8.6389
>T281719 WP_002391551.1 NZ_CP124911:2884269-2884412 [Enterococcus faecalis]
MNVSTKIYEKRGLLSIAEALALMISFGSFIATLIFGILEAVKEDNKK
MNVSTKIYEKRGLLSIAEALALMISFGSFIATLIFGILEAVKEDNKK
Download Length: 144 bp
Antitoxin
Download Length: 50 bp
>AT281719 NZ_CP124911:2884556-2884605 [Enterococcus faecalis]
AATAAAAATGCCCGAGCCTTAGAAAAATAAGAGGCTCGGGCATTTTTATT
AATAAAAATGCCCGAGCCTTAGAAAAATAAGAGGCTCGGGCATTTTTATT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|