Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | fst-RNAII/- |
Location | 319820..320014 | Replicon | chromosome |
Accession | NZ_CP124911 | ||
Organism | Enterococcus faecalis strain EfsC61 |
Toxin (Protein)
Gene name | fst | Uniprot ID | - |
Locus tag | QLQ53_RS01625 | Protein ID | WP_015543884.1 |
Coordinates | 319919..320014 (-) | Length | 32 a.a. |
Antitoxin (RNA)
Gene name | RNAII | ||
Locus tag | - | ||
Coordinates | 319820..319884 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QLQ53_RS01610 | 315438..317180 | + | 1743 | WP_002391519.1 | PTS transporter subunit EIIC | - |
QLQ53_RS01615 | 317171..319204 | + | 2034 | WP_002355275.1 | BglG family transcription antiterminator | - |
QLQ53_RS01620 | 319215..319649 | + | 435 | WP_002358391.1 | PTS sugar transporter subunit IIA | - |
- | 319820..319884 | + | 65 | - | - | Antitoxin |
QLQ53_RS01625 | 319919..320014 | - | 96 | WP_015543884.1 | type I toxin-antitoxin system Fst family toxin | Toxin |
QLQ53_RS01630 | 320260..322032 | + | 1773 | WP_002391520.1 | PTS mannitol-specific transporter subunit IIBC | - |
QLQ53_RS01635 | 322047..322484 | + | 438 | WP_002355279.1 | PTS sugar transporter subunit IIA | - |
QLQ53_RS01640 | 322499..323653 | + | 1155 | WP_002355280.1 | mannitol-1-phosphate 5-dehydrogenase | - |
QLQ53_RS01645 | 323722..324837 | - | 1116 | WP_002364956.1 | FAD-dependent oxidoreductase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 32 a.a. Molecular weight: 3659.47 Da Isoelectric Point: 4.6275
>T281700 WP_015543884.1 NZ_CP124911:c320014-319919 [Enterococcus faecalis]
MYEIVTKILVPIFVGIVLKLVTIWLEKQNEE
MYEIVTKILVPIFVGIVLKLVTIWLEKQNEE
Download Length: 96 bp
Antitoxin
Download Length: 65 bp
>AT281700 NZ_CP124911:319820-319884 [Enterococcus faecalis]
CTTGTGACAAAGTCGTGCATGGATGCACTAAAAAGACACCCTATTGTGGTAGGGTGTCTTTTTTT
CTTGTGACAAAGTCGTGCATGGATGCACTAAAAAGACACCCTATTGTGGTAGGGTGTCTTTTTTT
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|