Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type I Classification (family/domain) fst-RNAII/Fst(toxin)
Location 70415..70656 Replicon plasmid p2_EfsC33_rep9b
Accession NZ_CP124910
Organism Enterococcus faecalis strain EfsC33

Toxin (Protein)


Gene name fst Uniprot ID -
Locus tag QLQ33_RS15190 Protein ID WP_002360667.1
Coordinates 70415..70525 (+) Length 37 a.a.

Antitoxin (RNA)


Gene name RNAII
Locus tag -
Coordinates 70565..70656 (-)

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
QLQ33_RS15145 (65600) 65600..65806 + 207 Protein_69 transposase -
QLQ33_RS15150 (66336) 66336..66956 + 621 WP_002367819.1 recombinase family protein -
QLQ33_RS15155 (66946) 66946..67260 + 315 WP_048953689.1 hypothetical protein -
QLQ33_RS15160 (67254) 67254..67478 + 225 WP_002383635.1 ultraviolet resistance protein UvrA repressor UvrC -
QLQ33_RS15165 (67539) 67539..67748 + 210 WP_002383636.1 hypothetical protein -
QLQ33_RS15170 (67910) 67910..68062 + 153 WP_225850000.1 DUF6440 family protein -
QLQ33_RS15175 (68489) 68489..69817 + 1329 WP_002400994.1 ultraviolet resistance protein UvrA -
QLQ33_RS15180 (69814) 69814..70164 + 351 WP_002400993.1 hypothetical protein -
QLQ33_RS15185 (70121) 70121..70333 + 213 WP_002360669.1 hypothetical protein -
QLQ33_RS15190 (70415) 70415..70525 + 111 WP_002360667.1 type I toxin-antitoxin system Fst family toxin Toxin
- (70565) 70565..70656 - 92 NuclAT_0 - Antitoxin
- (70565) 70565..70656 - 92 NuclAT_0 - Antitoxin
- (70565) 70565..70656 - 92 NuclAT_0 - Antitoxin
- (70565) 70565..70656 - 92 NuclAT_0 - Antitoxin
QLQ33_RS15195 (70765) 70765..71061 + 297 WP_002360665.1 replication control protein PrgN -
QLQ33_RS15200 (71315) 71315..72097 + 783 WP_002360664.1 ParA family protein -
QLQ33_RS15205 (72090) 72090..72446 + 357 WP_002360663.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Mobilizable plasmid - prgB/asc10 1..72705 72705


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin


No domain identified.



Sequences

Toxin        


Download         Length: 37 a.a.        Molecular weight: 4117.92 Da        Isoelectric Point: 4.1672

>T281698 WP_002360667.1 NZ_CP124910:70415-70525 [Enterococcus faecalis]
VLFVKDLMSLVIAPIFVGLVLEMISRVLDEEDDNRK

Download         Length: 111 bp

Antitoxin


Download         Length: 92 bp

>AT281698 NZ_CP124910:c70656-70565 [Enterococcus faecalis]
TAAAAATATGTTATACTAAAGGTGCGAAACGACATTAAATCGTACAAATAACACAAAAAGCAATCCTACGGCGAATAGGA
TTGCTTTTTTTT

Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Download structure file

References