Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | fst-RNAII/Fst(toxin) |
Location | 70415..70656 | Replicon | plasmid p2_EfsC33_rep9b |
Accession | NZ_CP124910 | ||
Organism | Enterococcus faecalis strain EfsC33 |
Toxin (Protein)
Gene name | fst | Uniprot ID | - |
Locus tag | QLQ33_RS15190 | Protein ID | WP_002360667.1 |
Coordinates | 70415..70525 (+) | Length | 37 a.a. |
Antitoxin (RNA)
Gene name | RNAII | ||
Locus tag | - | ||
Coordinates | 70565..70656 (-) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QLQ33_RS15145 (65600) | 65600..65806 | + | 207 | Protein_69 | transposase | - |
QLQ33_RS15150 (66336) | 66336..66956 | + | 621 | WP_002367819.1 | recombinase family protein | - |
QLQ33_RS15155 (66946) | 66946..67260 | + | 315 | WP_048953689.1 | hypothetical protein | - |
QLQ33_RS15160 (67254) | 67254..67478 | + | 225 | WP_002383635.1 | ultraviolet resistance protein UvrA repressor UvrC | - |
QLQ33_RS15165 (67539) | 67539..67748 | + | 210 | WP_002383636.1 | hypothetical protein | - |
QLQ33_RS15170 (67910) | 67910..68062 | + | 153 | WP_225850000.1 | DUF6440 family protein | - |
QLQ33_RS15175 (68489) | 68489..69817 | + | 1329 | WP_002400994.1 | ultraviolet resistance protein UvrA | - |
QLQ33_RS15180 (69814) | 69814..70164 | + | 351 | WP_002400993.1 | hypothetical protein | - |
QLQ33_RS15185 (70121) | 70121..70333 | + | 213 | WP_002360669.1 | hypothetical protein | - |
QLQ33_RS15190 (70415) | 70415..70525 | + | 111 | WP_002360667.1 | type I toxin-antitoxin system Fst family toxin | Toxin |
- (70565) | 70565..70656 | - | 92 | NuclAT_0 | - | Antitoxin |
- (70565) | 70565..70656 | - | 92 | NuclAT_0 | - | Antitoxin |
- (70565) | 70565..70656 | - | 92 | NuclAT_0 | - | Antitoxin |
- (70565) | 70565..70656 | - | 92 | NuclAT_0 | - | Antitoxin |
QLQ33_RS15195 (70765) | 70765..71061 | + | 297 | WP_002360665.1 | replication control protein PrgN | - |
QLQ33_RS15200 (71315) | 71315..72097 | + | 783 | WP_002360664.1 | ParA family protein | - |
QLQ33_RS15205 (72090) | 72090..72446 | + | 357 | WP_002360663.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Mobilizable plasmid | - | prgB/asc10 | 1..72705 | 72705 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 37 a.a. Molecular weight: 4117.92 Da Isoelectric Point: 4.1672
>T281698 WP_002360667.1 NZ_CP124910:70415-70525 [Enterococcus faecalis]
VLFVKDLMSLVIAPIFVGLVLEMISRVLDEEDDNRK
VLFVKDLMSLVIAPIFVGLVLEMISRVLDEEDDNRK
Download Length: 111 bp
Antitoxin
Download Length: 92 bp
>AT281698 NZ_CP124910:c70656-70565 [Enterococcus faecalis]
TAAAAATATGTTATACTAAAGGTGCGAAACGACATTAAATCGTACAAATAACACAAAAAGCAATCCTACGGCGAATAGGA
TTGCTTTTTTTT
TAAAAATATGTTATACTAAAGGTGCGAAACGACATTAAATCGTACAAATAACACAAAAAGCAATCCTACGGCGAATAGGA
TTGCTTTTTTTT
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|