Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | fst-ratA/Fst(toxin) |
Location | 102052..102293 | Replicon | plasmid p1_EfsC33_rep9a |
Accession | NZ_CP124909 | ||
Organism | Enterococcus faecalis strain EfsC33 |
Toxin (Protein)
Gene name | fst | Uniprot ID | - |
Locus tag | QLQ33_RS14780 | Protein ID | WP_002360667.1 |
Coordinates | 102052..102162 (+) | Length | 37 a.a. |
Antitoxin (RNA)
Gene name | ratA | ||
Locus tag | - | ||
Coordinates | 102202..102293 (-) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QLQ33_RS14760 (99642) | 99642..100247 | + | 606 | WP_000238804.1 | recombinase family protein | - |
QLQ33_RS14765 (100294) | 100294..101454 | + | 1161 | WP_267594822.1 | Y-family DNA polymerase | - |
QLQ33_RS14770 (101451) | 101451..101801 | + | 351 | WP_002400993.1 | hypothetical protein | - |
QLQ33_RS14775 (101758) | 101758..101970 | + | 213 | WP_002360669.1 | hypothetical protein | - |
QLQ33_RS14780 (102052) | 102052..102162 | + | 111 | WP_002360667.1 | type I toxin-antitoxin system Fst family toxin | Toxin |
- (102202) | 102202..102293 | - | 92 | NuclAT_0 | - | Antitoxin |
- (102202) | 102202..102293 | - | 92 | NuclAT_0 | - | Antitoxin |
- (102202) | 102202..102293 | - | 92 | NuclAT_0 | - | Antitoxin |
- (102202) | 102202..102293 | - | 92 | NuclAT_0 | - | Antitoxin |
QLQ33_RS14785 (102402) | 102402..102692 | + | 291 | WP_049084802.1 | hypothetical protein | - |
QLQ33_RS14790 (102796) | 102796..103167 | - | 372 | WP_000049959.1 | replication-associated protein RepC | - |
QLQ33_RS14795 (103160) | 103160..104005 | - | 846 | WP_000239313.1 | AAA family ATPase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Non-Mobilizable plasmid | ant(6)-Ia / aph(3')-III / erm(B) | cylR2 / cylR1 / cylL / cylS / cylM / cylB / cylA / cylI / asa1 | 1..104476 | 104476 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 37 a.a. Molecular weight: 4117.92 Da Isoelectric Point: 4.1672
>T281694 WP_002360667.1 NZ_CP124909:102052-102162 [Enterococcus faecalis]
VLFVKDLMSLVIAPIFVGLVLEMISRVLDEEDDNRK
VLFVKDLMSLVIAPIFVGLVLEMISRVLDEEDDNRK
Download Length: 111 bp
Antitoxin
Download Length: 92 bp
>AT281694 NZ_CP124909:c102293-102202 [Enterococcus faecalis]
TAAAAATATGTTATACTAAAGGTGCGAAACGACATTAAATCGTACAAATAACACAAAAAGCAATCCTACGGCGAATAGGA
TTGCTTTTTTTT
TAAAAATATGTTATACTAAAGGTGCGAAACGACATTAAATCGTACAAATAACACAAAAAGCAATCCTACGGCGAATAGGA
TTGCTTTTTTTT
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|