Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | txpA-ratA/- |
Location | 2817550..2817886 | Replicon | chromosome |
Accession | NZ_CP124908 | ||
Organism | Enterococcus faecalis strain EfsC33 |
Toxin (Protein)
Gene name | txpA | Uniprot ID | A0A1J6YG70 |
Locus tag | QLQ33_RS13640 | Protein ID | WP_002396786.1 |
Coordinates | 2817550..2817693 (+) | Length | 48 a.a. |
Antitoxin (RNA)
Gene name | ratA | ||
Locus tag | - | ||
Coordinates | 2817837..2817886 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QLQ33_RS13620 (2812667) | 2812667..2812882 | - | 216 | WP_002354768.1 | zinc ribbon domain-containing protein | - |
QLQ33_RS13625 (2813021) | 2813021..2814013 | + | 993 | WP_023894581.1 | biotin--[acetyl-CoA-carboxylase] ligase | - |
QLQ33_RS13630 (2814277) | 2814277..2814915 | - | 639 | WP_002378863.1 | lytic polysaccharide monooxygenase | - |
QLQ33_RS13635 (2815601) | 2815601..2817217 | + | 1617 | WP_047648929.1 | phosphatase PAP2/LCP family protein | - |
QLQ33_RS13640 (2817550) | 2817550..2817693 | + | 144 | WP_002396786.1 | putative holin-like toxin | Toxin |
- (2817837) | 2817837..2817886 | + | 50 | NuclAT_11 | - | Antitoxin |
- (2817625) | 2817625..2817887 | - | 263 | NuclAT_8 | - | - |
QLQ33_RS13645 (2817888) | 2817888..2822579 | - | 4692 | WP_049098584.1 | WxL domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 48 a.a. Molecular weight: 5203.19 Da Isoelectric Point: 8.6626
>T281690 WP_002396786.1 NZ_CP124908:2817550-2817693 [Enterococcus faecalis]
MNVSTKIYERRGLLSIAEALALMISFGSFIATLIFGILEAVKEDNKK
MNVSTKIYERRGLLSIAEALALMISFGSFIATLIFGILEAVKEDNKK
Download Length: 144 bp
Antitoxin
Download Length: 50 bp
>AT281690 NZ_CP124908:2817837-2817886 [Enterococcus faecalis]
AATAAAAATGCCCGAGCCTTAGAAAAATAAGAGGCTCGGGCATTTTTATT
AATAAAAATGCCCGAGCCTTAGAAAAATAAGAGGCTCGGGCATTTTTATT
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|