Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | txpA-ratA/- |
Location | 2691321..2691583 | Replicon | chromosome |
Accession | NZ_CP124908 | ||
Organism | Enterococcus faecalis strain EfsC33 |
Toxin (Protein)
Gene name | txpA | Uniprot ID | S4BYM2 |
Locus tag | QLQ33_RS13085 | Protein ID | WP_002392696.1 |
Coordinates | 2691440..2691583 (-) | Length | 48 a.a. |
Antitoxin (RNA)
Gene name | ratA | ||
Locus tag | - | ||
Coordinates | 2691321..2691466 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QLQ33_RS13070 (2686686) | 2686686..2687399 | - | 714 | WP_002367455.1 | trehalose operon repressor | - |
QLQ33_RS13075 (2687661) | 2687661..2690405 | + | 2745 | WP_047648974.1 | glycosyl hydrolase family 65 protein | - |
QLQ33_RS13080 (2690420) | 2690420..2691070 | + | 651 | WP_002354875.1 | beta-phosphoglucomutase | - |
- (2691125) | 2691125..2691265 | + | 141 | NuclAT_7 | - | - |
- (2691321) | 2691321..2691466 | + | 146 | NuclAT_9 | - | Antitoxin |
- (2691321) | 2691321..2691507 | + | 187 | NuclAT_6 | - | - |
QLQ33_RS13085 (2691440) | 2691440..2691583 | - | 144 | WP_002392696.1 | type I toxin-antitoxin system toxin PepG1 | Toxin |
- (2691696) | 2691696..2691841 | + | 146 | NuclAT_10 | - | - |
- (2691684) | 2691684..2691882 | + | 199 | NuclAT_5 | - | - |
QLQ33_RS13090 (2691815) | 2691815..2691958 | - | 144 | WP_002392696.1 | type I toxin-antitoxin system toxin PepG1 | - |
QLQ33_RS13095 (2692190) | 2692190..2693161 | - | 972 | WP_002381060.1 | ribose-phosphate diphosphokinase | - |
QLQ33_RS13100 (2693336) | 2693336..2693773 | - | 438 | WP_002354871.1 | peptide-methionine (R)-S-oxide reductase MsrB | - |
QLQ33_RS13105 (2693906) | 2693906..2694460 | - | 555 | WP_002354869.1 | Maf family protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 48 a.a. Molecular weight: 5297.43 Da Isoelectric Point: 10.6867
>T281678 WP_002392696.1 NZ_CP124908:c2691583-2691440 [Enterococcus faecalis]
MSVLPKFTERRGLLSAYETIQTILGFGMFTIALIALIVKLLKNDNKK
MSVLPKFTERRGLLSAYETIQTILGFGMFTIALIALIVKLLKNDNKK
Download Length: 144 bp
Antitoxin
Download Length: 146 bp
>AT281678 NZ_CP124908:2691321-2691466 [Enterococcus faecalis]
TGTGCTATAATGAAAACGAAAAGAGAGATATGCGTCAACATACCTCTCTGATGTAGAGCCGTTTAAGACGGTGACCGATT
TTGTTACAAAAAATAACCGTACTCGATCAAAGTAAACGGTTATTTTTTATTGTCATTTTTAAGCAA
TGTGCTATAATGAAAACGAAAAGAGAGATATGCGTCAACATACCTCTCTGATGTAGAGCCGTTTAAGACGGTGACCGATT
TTGTTACAAAAAATAACCGTACTCGATCAAAGTAAACGGTTATTTTTTATTGTCATTTTTAAGCAA
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|