Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | fst-RNAII/- |
Location | 317624..317819 | Replicon | chromosome |
Accession | NZ_CP124908 | ||
Organism | Enterococcus faecalis strain EfsC33 |
Toxin (Protein)
Gene name | fst | Uniprot ID | - |
Locus tag | QLQ33_RS01630 | Protein ID | WP_015543884.1 |
Coordinates | 317724..317819 (-) | Length | 32 a.a. |
Antitoxin (RNA)
Gene name | RNAII | ||
Locus tag | - | ||
Coordinates | 317624..317689 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QLQ33_RS01615 (313250) | 313250..314998 | + | 1749 | WP_002397549.1 | PTS transporter subunit EIIC | - |
QLQ33_RS01620 (314989) | 314989..317022 | + | 2034 | WP_002397548.1 | BglG family transcription antiterminator | - |
QLQ33_RS01625 (317033) | 317033..317467 | + | 435 | WP_002358391.1 | PTS sugar transporter subunit IIA | - |
- (317624) | 317624..317689 | + | 66 | NuclAT_13 | - | Antitoxin |
QLQ33_RS01630 (317724) | 317724..317819 | - | 96 | WP_015543884.1 | type I toxin-antitoxin system Fst family toxin | Toxin |
QLQ33_RS01635 (318065) | 318065..319837 | + | 1773 | WP_002405272.1 | PTS mannitol-specific transporter subunit IIBC | - |
QLQ33_RS01640 (319852) | 319852..320289 | + | 438 | WP_002355279.1 | PTS sugar transporter subunit IIA | - |
QLQ33_RS01645 (320304) | 320304..321458 | + | 1155 | WP_002386082.1 | mannitol-1-phosphate 5-dehydrogenase | - |
QLQ33_RS01650 (321527) | 321527..322642 | - | 1116 | WP_002397546.1 | FAD-dependent oxidoreductase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 32 a.a. Molecular weight: 3659.47 Da Isoelectric Point: 4.6275
>T281671 WP_015543884.1 NZ_CP124908:c317819-317724 [Enterococcus faecalis]
MYEIVTKILVPIFVGIVLKLVTIWLEKQNEE
MYEIVTKILVPIFVGIVLKLVTIWLEKQNEE
Download Length: 96 bp
Antitoxin
Download Length: 66 bp
>AT281671 NZ_CP124908:317624-317689 [Enterococcus faecalis]
CTTGTGACAAAGTCGTGCATGGATGCACTAAAAAGACACCCTATCAGTAGTAGGGTGTCTTTTTTT
CTTGTGACAAAGTCGTGCATGGATGCACTAAAAAGACACCCTATCAGTAGTAGGGTGTCTTTTTTT
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|