Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | txpA-ratA/- |
Location | 2639037..2639366 | Replicon | chromosome |
Accession | NZ_CP124906 | ||
Organism | Enterococcus faecalis strain EfsC49 |
Toxin (Protein)
Gene name | txpA | Uniprot ID | A0A3N3Z2N6 |
Locus tag | QLQ59_RS12695 | Protein ID | WP_073340360.1 |
Coordinates | 2639037..2639177 (+) | Length | 47 a.a. |
Antitoxin (RNA)
Gene name | ratA | ||
Locus tag | - | ||
Coordinates | 2639317..2639366 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QLQ59_RS12675 | 2634251..2635243 | + | 993 | WP_002354765.1 | biotin--[acetyl-CoA-carboxylase] ligase | - |
QLQ59_RS12680 | 2635507..2636136 | - | 630 | WP_002354763.1 | lytic polysaccharide monooxygenase | - |
QLQ59_RS12685 | 2636829..2638445 | + | 1617 | Protein_2470 | phosphatase PAP2/LCP family protein | - |
QLQ59_RS12690 | 2638775..2638918 | + | 144 | WP_002392818.1 | type I toxin-antitoxin system toxin PepG1 | - |
QLQ59_RS12695 | 2639037..2639177 | + | 141 | WP_073340360.1 | putative holin-like toxin | Toxin |
- | 2639317..2639366 | + | 50 | - | - | Antitoxin |
QLQ59_RS12700 | 2639368..2642364 | - | 2997 | WP_002385134.1 | WxL domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 47 a.a. Molecular weight: 5218.33 Da Isoelectric Point: 10.3265
>T281670 WP_073340360.1 NZ_CP124906:2639037-2639177 [Enterococcus faecalis]
ISLKNTNKNIVYCTTYETIQTILGFGMFTIALIALIVKLLKNDKKK
ISLKNTNKNIVYCTTYETIQTILGFGMFTIALIALIVKLLKNDKKK
Download Length: 141 bp
Antitoxin
Download Length: 50 bp
>AT281670 NZ_CP124906:2639317-2639366 [Enterococcus faecalis]
AATAAAAATGCCCGAGCCTTAGAAAAATAAGAGGCTCGGGCATTTTTATT
AATAAAAATGCCCGAGCCTTAGAAAAATAAGAGGCTCGGGCATTTTTATT
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|