Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | txpA-ratA/- |
Location | 2560303..2560766 | Replicon | chromosome |
Accession | NZ_CP124906 | ||
Organism | Enterococcus faecalis strain EfsC49 |
Toxin (Protein)
Gene name | txpA | Uniprot ID | S4BYM2 |
Locus tag | QLQ59_RS12345 | Protein ID | WP_002392696.1 |
Coordinates | 2560303..2560446 (-) | Length | 48 a.a. |
Antitoxin (RNA)
Gene name | ratA | ||
Locus tag | - | ||
Coordinates | 2560622..2560766 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QLQ59_RS12330 | 2555644..2558388 | + | 2745 | WP_002392693.1 | glycosyl hydrolase family 65 protein | - |
QLQ59_RS12335 | 2558403..2559053 | + | 651 | WP_002354875.1 | beta-phosphoglucomutase | - |
QLQ59_RS12340 | 2559468..2559986 | + | 519 | WP_002354874.1 | PBECR4 domain-containing protein | - |
QLQ59_RS12345 | 2560303..2560446 | - | 144 | WP_002392696.1 | type I toxin-antitoxin system toxin PepG1 | Toxin |
- | 2560622..2560766 | + | 145 | - | - | Antitoxin |
QLQ59_RS12350 | 2560854..2560979 | - | 126 | WP_002383214.1 | hypothetical protein | - |
QLQ59_RS12355 | 2561184..2561390 | + | 207 | WP_224561207.1 | CPBP family intramembrane metalloprotease | - |
QLQ59_RS12360 | 2561443..2562414 | - | 972 | WP_002381060.1 | ribose-phosphate diphosphokinase | - |
QLQ59_RS12365 | 2562589..2563026 | - | 438 | WP_002354871.1 | peptide-methionine (R)-S-oxide reductase MsrB | - |
QLQ59_RS12370 | 2563159..2563713 | - | 555 | WP_002354869.1 | Maf family protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 48 a.a. Molecular weight: 5297.43 Da Isoelectric Point: 10.6867
>T281661 WP_002392696.1 NZ_CP124906:c2560446-2560303 [Enterococcus faecalis]
MSVLPKFTERRGLLSAYETIQTILGFGMFTIALIALIVKLLKNDNKK
MSVLPKFTERRGLLSAYETIQTILGFGMFTIALIALIVKLLKNDNKK
Download Length: 144 bp
Antitoxin
Download Length: 145 bp
>AT281661 NZ_CP124906:2560622-2560766 [Enterococcus faecalis]
TTGTGCTATAATGAAAACGAAAAGAGAGATATGCTTCAACATACCTCTCTGATGCAGAGCCGTTTAAGACGGTGACCGAT
TTTGTTACAAAAAATAACCGTACTCAGTCAAAGTAGACGGTTATTTTTTATTGTCATTTTTAACA
TTGTGCTATAATGAAAACGAAAAGAGAGATATGCTTCAACATACCTCTCTGATGCAGAGCCGTTTAAGACGGTGACCGAT
TTTGTTACAAAAAATAACCGTACTCAGTCAAAGTAGACGGTTATTTTTTATTGTCATTTTTAACA
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|