281647

Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) relE-dinJ/YafQ-DinJ
Location 2623101..2623635 Replicon chromosome
Accession NZ_CP124905
Organism Enterococcus faecalis strain EfsC85

Toxin (Protein)


Gene name relE Uniprot ID R3JX52
Locus tag QLQ41_RS12395 Protein ID WP_002360769.1
Coordinates 2623101..2623376 (-) Length 92 a.a.

Antitoxin (Protein)


Gene name dinJ Uniprot ID R3H6P0
Locus tag QLQ41_RS12400 Protein ID WP_002369771.1
Coordinates 2623369..2623635 (-) Length 89 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
QLQ41_RS12365 (2618273) 2618273..2618458 - 186 WP_002358660.1 hypothetical protein -
QLQ41_RS12370 (2618488) 2618488..2618817 + 330 WP_002358661.1 LPXTG cell wall anchor domain-containing protein -
QLQ41_RS12375 (2618945) 2618945..2619883 + 939 WP_002370935.1 2-dehydropantoate 2-reductase -
QLQ41_RS12380 (2619909) 2619909..2620946 + 1038 WP_002355369.1 PTS sugar transporter subunit IIC -
QLQ41_RS12385 (2621251) 2621251..2622145 - 895 Protein_2428 IS256 family transposase -
QLQ41_RS12390 (2622266) 2622266..2622910 + 645 WP_002377952.1 IS6 family transposase -
QLQ41_RS12395 (2623101) 2623101..2623376 - 276 WP_002360769.1 type II toxin-antitoxin system YafQ family toxin Toxin
QLQ41_RS12400 (2623369) 2623369..2623635 - 267 WP_002369771.1 type II toxin-antitoxin system RelB/DinJ family antitoxin Antitoxin
QLQ41_RS12405 (2623746) 2623746..2624330 - 585 WP_002377949.1 thermonuclease family protein -
QLQ41_RS12410 (2624354) 2624354..2624770 - 417 WP_010710134.1 single-stranded DNA-binding protein -
QLQ41_RS12415 (2624846) 2624846..2625094 - 249 WP_002360773.1 DUF3850 domain-containing protein -
QLQ41_RS12420 (2625107) 2625107..2625607 - 501 WP_002360775.1 DnaJ domain-containing protein -
QLQ41_RS12425 (2625640) 2625640..2625906 - 267 WP_002377947.1 hypothetical protein -
QLQ41_RS12430 (2626498) 2626498..2626986 - 489 WP_010710133.1 hypothetical protein -
QLQ41_RS12435 (2626992) 2626992..2627585 - 594 WP_002414802.1 replication-relaxation family protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
inside Integrative and Conjugative Element - esp / esp / cylI / cylA / cylB / cylM / cylS / cylL / cylR1 / cylR2 / bsh 2579741..2643244 63503


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin-antitoxin system, YafQ-like toxin

(3-91)

Antitoxin

RelB antitoxin/Antitoxin DinJ

(7-86)


Sequences

Toxin        


Download         Length: 92 a.a.        Molecular weight: 10732.58 Da        Isoelectric Point: 9.6918

>T281647 WP_002360769.1 NZ_CP124905:c2623376-2623101 [Enterococcus faecalis]
MLEIFYTNQFKKDFKKAKKQGKNLEKLKEVLVLLQEQQTLPPKYKDHALTGNYIGTRECHIEPDWLLIYKIDGDKLILTL
ARIGSHSELFR

Download         Length: 276 bp

Antitoxin


Download         Length: 89 a.a.        Molecular weight: 9772.09 Da        Isoelectric Point: 4.4791

>AT281647 WP_002369771.1 NZ_CP124905:c2623635-2623369 [Enterococcus faecalis]
VATTKKKPIHVNVDENLKEEAEQLFDDLGLNMTSAITIFLKQSINEQAIPFMINKGNKETLQALKDIKEGNVHGGFSSVE
DLMEDLNA

Download         Length: 267 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A0M2AEA7

Antitoxin

Source ID Structure
AlphaFold DB A0A0M2AED7

References